Taranor beacon_of_light: Unable to locate target 'target=healing_target'.
Nightkillerr is using an unsupported spec.
close

SimulationCraft 623-01

for World of Warcraft 6.2.3 Live (build level 20726)

Current simulator hotfixes

General

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-09-01 Touch of the Grave now scales its damage based on 50% of the character's Attack Power or Spell Power, whichever is greater.
Touch of the Grave (effect#1) average 0.00 8.00

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Bestial Wrath now lasts 15 seconds (up from 10 seconds).
Bestial Wrath duration 15000.00 10000.00
2015-07-20 Serpent Sting damage increased by 25%.
Serpent Sting (effect#1) ap_coefficient 0.91 0.73
2015-07-20 Black Arrow damage increased by 25%.
Black Arrow (effect#1) ap_coefficient 0.71 0.57

Item

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-11-18 Infallible Tracking Charm now has a massively increased damage and chance to trigger, but now only increases damage against demons for 5 seconds (down from 10 seconds.)
Demonbane rppm 3.00 0.96

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Dragon's Breath damage increased by 150%
Dragon's Breath (effect#1) sp_coefficient 2.15 0.86
2015-07-20 Flamestrike DOT damage increased by 50%
Flamestrike (effect#2) sp_coefficient 0.15 0.10
2015-07-20 Flamestrike impact damage increased by 50%
Flamestrike (effect#1) sp_coefficient 1.17 0.78

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Mastery: Molten Earth damage has been increased by 11%.
Molten Earth (effect#1) sp_coefficient 1.11 1.00
2015-07-20 Ascendance now has a 2-minute cooldown (down from 3 minutes) for Elemental Shaman.
Ascendance cooldown 120000.00 180000.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Incinerate damage increased by 5%.
Incinerate (effect#1) sp_coefficient 1.51 1.43
2015-07-20 Immolate damage increased by 5%.
Immolate (effect#1) sp_coefficient 0.52 0.50
2015-07-20 Conflagrate damage increased by 5%.
Conflagrate (effect#1) sp_coefficient 2.14 2.04
2015-07-20 Chaos Bolt damage increased by 5%.
Chaos Bolt (effect#1) sp_coefficient 2.39 2.28
2015-07-20 Conflagrate damage increased by 5%.
Conflagrate (effect#1) sp_coefficient 2.14 2.04
2015-07-20 Shadowburn damage increased by 5%.
Shadowburn (effect#2) sp_coefficient 3.57 3.40
2015-07-20 Incinerate damage increased by 5%.
Incinerate (effect#1) sp_coefficient 1.51 1.43
2015-07-20 Immolate damage increased by 5%.
Immolate (effect#1) sp_coefficient 0.52 0.50
2015-07-20 Chaos Bolt damage increased by 5%.
Chaos Bolt (effect#1) sp_coefficient 2.39 2.28

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Shaque

Shaque : 89095 dps, 89095 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
89094.8 89094.8 30.0 / 0.034% 9332.0 / 10.5% 11108.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.8 6.8 Runic Power 14.38% 60.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/arathor/Shaque/advanced
Talents
  • 15: Unholy Blight
  • 30: Purgatory
  • 45: Death's Advance
  • 60: Blood Tap
  • 75: Death Pact
  • 90: Gorefiend's Grasp
  • 100: Necrotic Plague
  • Talent Calculator
Glyphs
  • Glyph of Raise Ally
  • Glyph of Regenerative Magic
  • Glyph of Blood Boil
  • Glyph of Tranquil Grip
  • Glyph of the Skeleton
  • Glyph of Path of Frost
Professions
  • herbalism: 700
  • blacksmithing: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Shaque 89095
auto_attack_mh 8374 9.4% 203.0 2.22sec 18545 8381 Direct 203.0 10781 22005 13580 24.9% 247.4 3235 6599 25.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.02 203.02 0.00 0.00 2.2126 0.0000 3765014.24 5786232.41 34.93 8381.47 8381.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 61.75 24.96% 6599.32 4779 11074 6602.12 5956 7455 407481 626234 34.93
multistrike 185.66 75.04% 3234.80 2343 5428 3236.20 3040 3553 600558 922963 34.93
hit 152.40 75.07% 10781.36 7809 18094 10785.92 10193 11606 1643073 2525144 34.93
crit 50.62 24.93% 22004.58 15930 36912 22014.24 19815 24709 1113902 1711891 34.93
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Death Coil 8039 9.0% 137.5 3.24sec 26288 26170 Direct 137.5 15284 31165 19251 25.0% 167.6 4585 9350 24.9%  

Stats details: death_coil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 137.48 137.48 0.00 0.00 1.0045 0.0000 3614010.70 3614010.70 0.00 26170.47 26170.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 41.76 24.91% 9350.42 6378 16636 9355.06 8151 10822 390448 390448 0.00
multistrike 125.85 75.09% 4584.59 3126 8155 4586.78 4213 5116 576955 576955 0.00
hit 103.14 75.02% 15284.48 10422 27183 15291.72 14200 16937 1576381 1576381 0.00
crit 34.34 24.98% 31165.06 21260 55453 31177.03 26780 37433 1070226 1070226 0.00
 
 

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.sudden_doom.react|runic_power>80)&(buff.blood_charge.stack<=10)
Spelldata
  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target, causing $<damage> Shadow damage to an enemy or healing an Undead ally for $<healing>{$?s58677=false}[. Refunds {$58677s1=20} Runic Power when used to heal.][.]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Festering Strike 6056 6.8% 50.6 8.89sec 53761 53521 Direct 50.6 31256 63751 39371 25.0% 61.7 9377 19128 24.9%  

Stats details: festering_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.62 50.62 0.00 0.00 1.0045 0.0000 2721365.31 4182308.79 34.93 53520.67 53520.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 15.38 24.93% 19128.43 13606 31273 19145.07 15673 24509 294187 452119 34.93
multistrike 46.31 75.07% 9376.73 6670 15330 9384.08 8348 10672 434267 667401 34.93
hit 37.98 75.03% 31256.02 22232 51099 31280.80 28349 35273 1187075 1824347 34.93
crit 12.64 24.97% 63751.32 45353 104242 63797.48 49758 80921 805836 1238442 34.93
 
 

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.necrotic_plague.enabled&talent.unholy_blight.enabled&dot.necrotic_plague.remains<cooldown.unholy_blight.remains%2
Spelldata
  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Deals $sw2 Physical damage and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to {$s3=6} sec.{$?s56835=false}[ The Runes spent on this ability will become Death Runes when they activate. Death Runes count as any type of Rune.][]
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.03
 
Necrosis 7078 7.9% 477.8 1.92sec 6658 0 Direct 477.8 3871 7897 4875 24.9% 582.5 1161 2369 25.0%  

Stats details: necrosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 477.85 477.85 0.00 0.00 0.0000 0.0000 3181402.57 3181402.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 145.34 24.95% 2369.11 1615 4210 2370.16 2184 2613 344328 344328 0.00
multistrike 437.12 75.05% 1161.26 791 2064 1161.77 1081 1285 507612 507612 0.00
hit 358.65 75.06% 3870.72 2638 6880 3872.44 3619 4251 1388237 1388237 0.00
crit 119.20 24.94% 7896.51 5382 14035 7899.91 7241 8836 941226 941226 0.00
 
 

Action details: necrosis

Static Values
  • id:168828
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:168828
  • name:Necrosis
  • school:shadow
  • tooltip:
  • description:{$@spelldesc165395=You gain {$s1=5}% more of the Multistrike stat from all sources. Your Scourge Strike, Festering Strike, Plague Strike, Soul Reaper, and Blood Boil multistrikes deal an additional {$168828s1=0 to 2} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.202400
  • spell_power_mod.direct:0.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Necrotic Plague 12789 14.4% 53.9 7.76sec 106715 0 Periodic 220.6 15162 30924 19096 25.0% 268.9 4549 9276 24.9% 98.0%

Stats details: necrotic_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.91 53.91 220.59 220.59 0.0000 2.0000 5752671.02 5752671.02 0.00 13039.58 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 67.1 24.94% 9276.12 451 17604 9280.80 7881 10907 622116 622116 0.00
multistrike 201.9 75.06% 4548.89 221 8629 4551.19 4034 5162 918258 918258 0.00
hit 165.5 75.04% 15161.87 736 28765 15169.31 13638 16922 2509737 2509737 0.00
crit 55.1 24.96% 30924.16 1502 58680 30940.20 26198 36196 1702561 1702561 0.00
 
 

Action details: necrotic_plague

Static Values
  • id:155159
  • school:shadowfrost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:155159
  • name:Necrotic Plague
  • school:shadowfrost
  • tooltip:Suffering $w1 Shadowfrost damage every $t1 sec. Each time it deals damage, it gains 1 stack, and infects another nearby enemy if possible.$?$w2>0[ The Death Knight will gain ${$155165m~1/10} Runic Power whenever an infected target attempts to attack them.][]
  • description:{$@spelldesc152281=A powerful disease that deals {$155159s1=1} Shadowfrost damage per stack every $155159t1 sec for {$155159d=30 seconds}. Each time it deals damage, it gains 1 stack, and infects another nearby enemy within {$s2=8} yards if possible. $?c1[ You gain ${$155165m1/10} Runic Power whenever a target infected with Necrotic Plague attempts to attack you.][] Replaces Blood Plague and Frost Fever, and is applied by any ability which applied either. This effect cannot be refreshed; it gains 1 stack instead.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.035200
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Plague Strike 2 0.0% 0.1 165.25sec 8743 8729 Direct 0.1 5045 10350 6419 25.9% 0.1 1517 3111 25.0%  

Stats details: plague_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.10 0.10 0.00 0.00 1.0045 0.0000 881.64 1354.94 34.93 8729.08 8729.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.03 25.05% 3110.92 2245 5161 88.48 0 5161 95 146 0.99
multistrike 0.09 74.95% 1516.93 1101 2530 105.58 0 2530 139 213 2.43
hit 0.07 74.06% 5044.73 3669 8432 369.84 0 8432 377 579 2.56
crit 0.03 25.94% 10350.01 7484 17202 270.37 0 17202 271 416 0.91
 
 

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.necrotic_plague.enabled&!(dot.blood_plague.ticking|dot.frost_fever.ticking))|(talent.necrotic_plague.enabled&!dot.necrotic_plague.ticking)
Spelldata
  • id:45462
  • name:Plague Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals $sw3 Physical damage and infects the target with Blood Plague{$?s51160=false}[ and Frost Fever][]. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {$@spelldesc55078=A disease that deals Shadow damage every $t1 sec for {$d=30 seconds}.} {$?s51160=false}[ |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals Frost damage every $t1 sec for {$d=30 seconds}.}][]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.50
 
Scourge Strike 8170 (17894) 9.2% (20.1%) 138.0 3.25sec 58304 58043 Direct 138.0 15478 31573 19489 24.9% 168.2 4643 9473 24.9%  

Stats details: scourge_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 137.97 137.97 0.00 0.00 1.0045 0.0000 3672511.47 5644070.25 34.93 58042.77 58042.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 41.95 24.94% 9473.41 6916 15895 9474.25 8515 10735 397433 610792 34.93
multistrike 126.26 75.06% 4643.24 3390 7792 4643.93 4301 5067 586275 901013 34.93
hit 103.58 75.08% 15477.51 11300 25973 15479.92 14606 16912 1603210 2463881 34.93
crit 34.38 24.92% 31573.48 23053 52985 31578.89 28236 36445 1085593 1668385 34.93
 
 

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:unholy=2
Spelldata
  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:
  • description:An unholy strike that deals $sw2 Physical damage and $70890sw2 Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.54
 
    Scourge Strike (_shadow) 9724 10.9% 0.0 0.00sec 0 0 Direct 138.0 18421 37573 23197 24.9% 168.2 5527 11274 25.0%  

Stats details: scourge_strike_shadow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 137.96 0.00 0.00 0.0000 0.0000 4371461.80 4371461.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 41.98 24.96% 11273.71 8191 18825 11274.95 10028 13017 473325 473325 0.00
multistrike 126.25 75.04% 5526.91 4015 9228 5527.85 5150 5979 697774 697774 0.00
hit 103.56 75.06% 18421.24 13383 30760 18424.20 17325 19962 1907720 1907720 0.00
crit 34.40 24.94% 37573.16 27302 62751 37580.36 33690 42886 1292643 1292643 0.00
 
 

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:70890
  • name:Scourge Strike
  • school:shadow
  • tooltip:
  • description:{$@spelldesc55090=An unholy strike that deals $sw2 Physical damage and $70890sw2 Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.77
 
Soul Reaper 9789 11.0% 33.1 6.45sec 133159 132564 Direct 33.1 10054 20512 12674 25.1% 40.3 3016 6151 25.0%  
Periodic 32.3 69009 140698 86875 24.9% 39.3 20698 42249 25.0% 35.9%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.06 33.06 32.28 32.28 1.0045 5.0000 4401640.32 4708689.88 6.52 22617.98 132563.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.06 24.97% 6150.58 4492 10409 6155.61 0 9195 61845 95045 34.93
multistrike 30.22 75.03% 3016.49 2202 5103 3019.12 2697 3491 91151 140085 34.93
hit 24.77 74.94% 10054.27 7340 17008 10063.04 9045 11375 249077 382792 34.93
crit 8.28 25.06% 20512.11 14974 34697 20528.00 0 29659 169883 261083 34.93
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.8 24.98% 42248.85 29264 76331 42300.10 0 60593 414826 414826 0.00
multistrike 29.5 75.02% 20698.04 14345 37417 20719.56 17998 24422 610489 610489 0.00
hit 24.2 75.08% 69008.83 47818 124724 69080.31 60874 83164 1672513 1672513 0.00
crit 8.0 24.92% 140698.43 97548 254437 140808.26 0 226012 1131858 1131858 0.00
 
 

Action details: soul_reaper

Static Values
  • id:130736
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(target.health.pct-3*(target.health.pct%target.time_to_die))<=45
Spelldata
  • id:130736
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadowfrost damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains {$114868s1=50}% haste for {$114868d=5 seconds}.
  • description:Strikes an enemy for $sw1 Physical damage and afflicts the target with Soul Reaper. After {$d=5 seconds}, if the target is below $?p138347|s157342[{$157342s1=45}][35]% health, this effect will deal {$114867s1=0} additional Shadowfrost damage. If the enemy dies before this effect triggers, the Death Knight gains {$114868s1=50}% haste for {$114868d=5 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.94
 

Action details: soul_reaper_execute

Static Values
  • id:114867
  • school:shadowfrost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc114866=Strikes an enemy for $sw1 Physical damage, afflicts the target with Soul Reaper, and increases the healing from your next Death Strike by {$50421s1=20}%. After {$d=5 seconds}, if the target is below $?p138347[{$138347s1=45}][35]% health, this effect will deal {$114867s1=0} additional Shadowfrost damage. If the enemy dies before this effect triggers, the Death Knight gains {$114868s1=50}% haste for {$114868d=5 seconds}.}
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Thorasus 5405 6.1% 4.2 120.42sec 582162 0 Direct 4.2 582164 0 582164 0.0% 0.0 0 0 0.0%  

Stats details: thorasus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.17 4.17 0.00 0.00 0.0000 0.0000 2425406.25 2425406.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.17 100.00% 582163.57 267513 1081865 582471.40 445807 747654 2425406 2425406 0.00
 
 

Action details: thorasus

Static Values
  • id:187624
  • school:arcane
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187624
  • name:Thorasus
  • school:arcane
  • tooltip:
  • description:{$@spelldesc187614=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1652762.46
  • base_dd_max:1652762.46
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
pet - gargoyle 14682 / 3763
Gargoyle Strike 14682 4.2% 84.7 4.67sec 19826 16080 Direct 84.7 11618 23230 14515 24.9% 103.3 3485 6966 25.0%  

Stats details: gargoyle_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.71 84.71 0.00 0.00 1.2329 0.0000 1679519.56 1679519.56 0.00 16080.42 16080.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 25.79 24.96% 6966.46 4847 10993 6971.69 5554 8876 179651 179651 0.00
multistrike 77.54 75.04% 3485.25 2423 5497 3487.77 3039 4100 270234 270234 0.00
hit 63.58 75.05% 11618.12 8078 18322 11626.39 10101 13355 738659 738659 0.00
crit 21.14 24.95% 23230.07 16156 36644 23247.92 18253 29318 490976 490976 0.00
 
 

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:shadowstorm
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts Plague (Nature and Shadow) damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.330000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - ghoul 9508 / 9508
auto_attack_mh 6065 6.8% 446.4 1.01sec 6109 6067 Direct 446.4 3580 7159 4473 24.9% 544.2 1074 2148 25.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 446.43 446.43 0.00 0.00 1.0068 0.0000 2727076.65 4191086.23 34.93 6067.14 6067.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 135.87 24.97% 2147.60 754 4106 2148.37 1910 2521 291803 448454 34.93
multistrike 408.33 75.03% 1073.90 377 2053 1074.30 994 1221 438503 673910 34.93
hit 335.07 75.06% 3579.89 1257 6843 3581.21 3310 4019 1199511 1843459 34.93
crit 111.36 24.94% 7159.20 2514 13686 7161.90 6359 8170 797260 1225263 34.93
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Claw 462 0.5% 44.9 10.41sec 4624 0 Direct 44.9 2712 5418 3385 24.9% 54.7 814 1625 24.9%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.86 44.86 0.00 0.00 0.0000 0.0000 207407.32 318752.30 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.64 24.95% 1625.10 943 3208 1626.39 1135 2589 22167 34067 34.93
multistrike 41.04 75.05% 813.69 471 1604 814.40 671 997 33394 51321 34.93
hit 33.70 75.13% 2712.24 1571 5346 2714.48 2245 3249 91414 140488 34.93
crit 11.15 24.87% 5417.81 3143 10692 5421.65 0 8378 60433 92875 34.93
 
 

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=1}% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.25
 
Monstrous Blow 156 0.2% 7.5 62.04sec 9304 0 Direct 7.5 5449 10911 6814 25.0% 9.2 1634 3272 25.0%  

Stats details: monstrous_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.52 7.52 0.00 0.00 0.0000 0.0000 70000.83 107580.22 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.29 25.01% 3272.17 2263 5132 2986.48 0 5132 7500 11526 31.80
multistrike 6.87 74.99% 1634.32 1131 2566 1638.67 0 2566 11232 17262 34.93
hit 5.64 75.01% 5449.35 3771 8554 5464.48 3771 8554 30756 47267 34.93
crit 1.88 24.99% 10911.47 7542 17107 9609.24 0 17107 20513 31525 30.70
 
 

Action details: monstrous_blow

Static Values
  • id:91797
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91797
  • name:Monstrous Blow
  • school:physical
  • tooltip:Stunned.
  • description:Strike an enemy with a smashing attack, dealing {$s2=1}% of normal melee damage and stunning for {$d=4 seconds}.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.25
 
Sweeping Claws 2825 3.2% 126.7 3.46sec 10027 9982 Direct 126.7 5878 11752 7342 24.9% 154.4 1763 3526 25.0%  

Stats details: sweeping_claws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.70 126.70 0.00 0.00 1.0045 0.0000 1270386.89 1952384.06 34.93 9982.06 9982.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 38.53 24.96% 3525.60 2715 6159 3526.37 3087 4050 135836 208758 34.93
multistrike 115.86 75.04% 1763.22 1358 3079 1763.59 1609 1970 204291 313962 34.93
hit 95.11 75.07% 5877.62 4525 10264 5878.85 5381 6536 559001 859096 34.93
crit 31.59 24.93% 11752.44 9051 20528 11754.64 10097 13784 371260 570568 34.93
 
 

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91778
  • name:Sweeping Claws
  • school:physical
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$91778s1=2}% of normal damage to the target and up to ${$91778x1-1} additional targets.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.50
 
pet - army_of_the_dead 5033 / 398
auto_attack_mh 3001 0.3% 280.0 0.98sec 375 378 Direct 280.0 220 440 275 25.0% 341.4 66 132 24.9%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 280.00 280.00 0.00 0.00 0.9931 0.0000 105049.59 161444.64 34.93 377.79 377.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 85.17 24.95% 131.90 78 177 131.91 109 149 11234 17265 34.93
multistrike 256.24 75.05% 65.95 39 89 65.95 55 73 16899 25972 34.93
hit 210.13 75.05% 219.82 130 296 219.83 186 240 46192 70990 34.93
crit 69.87 24.95% 439.75 261 592 439.74 356 503 30725 47219 34.93
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Claw 2032 0.2% 152.0 2.08sec 468 0 Direct 152.0 274 548 343 25.0% 185.2 82 165 24.9%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 152.00 152.00 0.00 0.00 0.0000 0.0000 71106.57 109279.58 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 46.19 24.93% 164.51 98 222 164.50 136 193 7598 11678 34.93
multistrike 139.05 75.07% 82.25 49 111 82.25 70 91 11437 17577 34.93
hit 114.05 75.03% 274.13 163 370 274.13 234 299 31265 48049 34.93
crit 37.95 24.97% 548.29 326 740 548.29 450 654 20806 31976 34.93
 
 

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=1}% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.25
 
Simple Action Stats Execute Interval
Shaque
Anti-Magic Shell 8.0 60.42sec

Stats details: antimagic_shell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: antimagic_shell

Static Values
  • id:48707
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shaque
  • harmful:false
  • if_expr:((dot.breath_of_sindragosa.ticking&runic_power<25)|cooldown.breath_of_sindragosa.remains>40)|!talent.breath_of_sindragosa.enabled
Spelldata
  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to $w1 magic damage. Immune to magic debuffs.
  • description:Surrounds the Death Knight in an Anti-Magic Shell for {$d=5 seconds}, absorbing {$s1=100}% of all magical damage and preventing application of harmful magical effects. {$?s159415=false}[][Damage absorbed generates Runic Power.]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Army of the Dead 1.0 0.00sec

Stats details: army_of_the_dead

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 15.00 15.00 0.0000 0.2440 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.75 75.00% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.25 25.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: army_of_the_dead

Static Values
  • id:42650
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:600.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning Ghouls.
  • description:Summons a legion of Ghouls over {$d=4 seconds} who will fight for the Death Knight for {$42651d=40 seconds}, swarming the area, taunting and fighting anything they can.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:30.00
 
Blood Tap 53.8 8.04sec

Stats details: blood_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.84 53.84 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.40 75.03% 0.00 0 0 0.00 0 0 0 0 0.00
crit 13.45 24.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((target.health.pct-3*(target.health.pct%target.time_to_die))<=45)&cooldown.soul_reaper.remains=0
Spelldata
  • id:45529
  • name:Blood Tap
  • school:physical
  • tooltip:
  • description:Every {$s1=15} Runic Power you spend will generate a Blood Charge. Max {$114851u=12} charges. Blood Tap consumes {$114851s1=5} Blood Charges to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Dark Transformation 11.6 39.57sec

Stats details: dark_transformation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.58 11.58 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.67 74.87% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.91 25.13% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $w1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for {$d=30 seconds}. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:0.00
 
Draenic Strength Potion (potion) 2.0 0.00sec

Stats details: draenic_strength_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: potion

Static Values
  • id:156428
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156428
  • name:Draenic Strength Potion
  • school:physical
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your Strength by {$s1=1000} for {$d=25 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Empower Rune Weapon 2.0 304.71sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.95 1.95 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.47 75.11% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.49 24.89% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.breath_of_sindragosa.enabled
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
 
Horn of Winter 1.0 0.00sec

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.75 74.92% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.25 25.08% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by {$s1=10}%.
  • description:The Death Knight blows the Horn of Winter, increasing attack power of all party and raid members within $a1 yards by {$s1=10}% for {$d=3600 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Outbreak 5.2 94.39sec

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.23 5.23 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.23 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.necrotic_plague.enabled&(!(dot.blood_plague.ticking|dot.frost_fever.ticking))
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {$@spelldesc55078=A disease that deals Shadow damage every $t1 sec for {$d=30 seconds}.} |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals Frost damage every $t1 sec for {$d=30 seconds}.}
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Raise Dead 1.0 0.00sec

Stats details: raise_dead

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.75 74.95% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.25 25.05% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: raise_dead

Static Values
  • id:46584
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Summon Gargoyle 3.0 180.59sec

Stats details: summon_gargoyle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.03 3.03 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.27 74.91% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.76 25.09% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target for {$61777d=30 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Unholy Blight 4.9 101.07sec

Stats details: unholy_blight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.92 4.92 48.57 48.57 1.0045 1.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.5 75.08% 0.00 0 0 0.00 0 0 0 0 0.00
crit 12.1 24.92% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: unholy_blight

Static Values
  • id:115989
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!disease.min_ticking
Spelldata
  • id:115989
  • name:Unholy Blight
  • school:shadow
  • tooltip:Surrounded by a vile swarm of unholy insects. Infecting nearby enemies with Blood Plague and Frost Fever every $t1 sec.
  • description:Surrounds the Death Knight with a vile swarm of unholy insects for {$115989d=10 seconds}, stinging all enemies within $115994A1 yards, infecting them with Blood Plague and Frost Fever.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 

Action details: unholy_blight_tick

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
unholy_presence 1.0 0.00sec

Stats details: unholy_presence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.75 75.15% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.25 24.85% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: unholy_presence

Static Values
  • id:48265
  • school:none
  • resource:runic_power
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 
Unholy Strength 38.8 11.75sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 38.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shaque
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=3}% and increase total Strength by {$53365s1=20}% for {$53365d=15 seconds}.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Blood Charge 4.1 133.4 119.8sec 3.2sec 97.07% 97.07% 0.0(0.0)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_blood_charge
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blood_charge_1:2.25%
  • blood_charge_2:4.24%
  • blood_charge_3:4.47%
  • blood_charge_4:6.04%
  • blood_charge_5:4.68%
  • blood_charge_6:13.57%
  • blood_charge_7:11.78%
  • blood_charge_8:14.03%
  • blood_charge_9:13.05%
  • blood_charge_10:13.05%
  • blood_charge_11:4.97%
  • blood_charge_12:4.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114851
  • name:Blood Charge
  • tooltip:Stored blood energy. Blood Tap consumes 5 Blood Charges to activate a random fully-depleted rune as a Death Rune.
  • description:{$@spelldesc45529=Every {$s1=15} Runic Power you spend will generate a Blood Charge. Max {$114851u=12} charges. Blood Tap consumes {$114851s1=5} Blood Charges to activate a random fully-depleted rune as a Death Rune.}
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.03% 11.08% 0.0(0.0)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crazed Monstrosity 11.6 0.0 39.6sec 39.6sec 74.61% 54.78% 0.0(0.0)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_crazed_monstrosity
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crazed_monstrosity_1:74.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187981
  • name:Crazed Monstrosity
  • tooltip:Damage increased by $m2%, and attack speed increased by $m3%.
  • description:{$@spelldesc187865=Your Death Coil applies double the amount of Shadow Infusion onto your Ghoul.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dark Transformation 11.6 0.0 39.6sec 39.6sec 74.61% 79.07% 0.0(0.0)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • dark_transformation_1:74.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63560
  • name:Dark Transformation
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $w1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for {$d=30 seconds}. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Draenic Strength Potion 2.0 0.0 397.5sec 0.0sec 10.84% 10.85% 0.0(0.0)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_draenic_strength_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1000.00

Stack Uptimes

  • draenic_strength_potion_1:10.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156428
  • name:Draenic Strength Potion
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your Strength by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Hungering Blows (hammering_blows) 6.6 230.4 71.1sec 1.8sec 35.75% 35.76% 104.9(103.5)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_hammering_blows
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:78.00

Stack Uptimes

  • hammering_blows_1:1.03%
  • hammering_blows_2:1.13%
  • hammering_blows_3:1.07%
  • hammering_blows_4:0.89%
  • hammering_blows_5:1.12%
  • hammering_blows_6:1.02%
  • hammering_blows_7:1.14%
  • hammering_blows_8:0.93%
  • hammering_blows_9:0.97%
  • hammering_blows_10:1.14%
  • hammering_blows_11:0.91%
  • hammering_blows_12:0.94%
  • hammering_blows_13:1.12%
  • hammering_blows_14:0.93%
  • hammering_blows_15:0.93%
  • hammering_blows_16:1.14%
  • hammering_blows_17:0.90%
  • hammering_blows_18:1.06%
  • hammering_blows_19:0.97%
  • hammering_blows_20:16.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:183941
  • name:Hungering Blows
  • tooltip:Increases Strength by {$s1=24}. Additional attacks will add stacks of this effect.
  • description:Increases Strength by {$s1=24} for {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Shadow Infusion 11.8 23.3 39.4sec 12.6sec 19.27% 15.67% 11.6(11.6)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_shadow_infusion
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_infusion_2:8.04%
  • shadow_infusion_4:8.23%
  • shadow_infusion_5:3.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:91342
  • name:Shadow Infusion
  • tooltip:$?$w3>0[Pet damage dealt increased by {$s1=10}%.][Damage dealt increased by {$s1=10}%.]
  • description:Grants your successful Death Coils a chance to empower your active Ghoul, increasing its damage dealt by {$91342s1=10}% for {$91342d=30 seconds}. Stacks up to 5 times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 36.0 0.5 12.3sec 12.3sec 7.45% 7.47% 0.5(0.0)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sudden_doom_1:7.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil consumes no Runic Power.
  • description:While in Unholy Presence, your main-hand autoattacks have a chance to cause your next Death Coil to consume no Runic Power.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Thorasus 4.4 0.0 120.4sec 120.4sec 14.28% 16.26% 0.0(0.0)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_thorasus
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35

Stack Uptimes

  • thorasus_1:14.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187619
  • name:Thorasus
  • tooltip:$?$w1>0[Damage dealt increased by $w1%. When this effect ends, the triggering ally will explode for $w1% of all damage dealt while empowered.][Contributing toward the master's Savage Hollows.]
  • description:{$@spelldesc187614=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Strength 12.8 25.9 36.2sec 11.7sec 78.51% 78.30% 25.9(25.9)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:78.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=20}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=3}% and increase total Strength by {$53365s1=20}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Crazed Monstrosity 11.6 0.0 39.6sec 39.6sec 74.61% 79.07% 0.0(0.0)

Buff details

  • buff initial source:Shaque_ghoul
  • cooldown name:buff_crazed_monstrosity
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crazed_monstrosity_1:74.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187970
  • name:Crazed Monstrosity
  • tooltip:Damage increased by $m2%, and attack speed increased by $m3%.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Stance of the Fierce Tiger (fierce_tiger_movement_aura)

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_fierce_tiger_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fierce_tiger_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:
  • description:Increases all damage dealt by {$s3=10}%. Grants you and your allies within $m7 yards {$166646s1=10}% increased movement speed, and improves the functionality of Jab, Expel Harm, Tiger Palm, Blackout Kick, and Rising Sun Kick.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Draenic Strength Flask

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
salty_squid_roll_food

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_salty_squid_roll_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:125.00

Stack Uptimes

  • salty_squid_roll_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
Unholy Presence

Buff details

  • buff initial source:Shaque
  • cooldown name:buff_unholy_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • unholy_presence_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48265
  • name:Unholy Presence
  • tooltip:Haste increased by $w1%. Movement speed increased by {$s2=15}%.
  • description:You are infused with unholy fury, increasing haste by {$s1=10}%, and movement speed by {$s2=15}%. Activating a new Presence will cancel this one and consume {$?s58647=false}[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%
Stance of the Fierce Tiger (fierce_tiger_movement_aura)

Buff details

  • buff initial source:Shaque_ghoul
  • cooldown name:buff_fierce_tiger_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fierce_tiger_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:
  • description:Increases all damage dealt by {$s3=10}%. Grants you and your allies within $m7 yards {$166646s1=10}% increased movement speed, and improves the functionality of Jab, Expel Harm, Tiger Palm, Blackout Kick, and Rising Sun Kick.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Shaque
death_coil Runic Power 137.5 3047.3 22.2 22.2 1186.0
pet - ghoul
claw Energy 44.9 1794.3 40.0 40.0 115.6
sweeping_claws Energy 126.7 5067.9 40.0 40.0 250.7
pet - army_of_the_dead
claw Energy 152.0 6080.0 40.0 40.0 11.7
Resource Gains Type Count Total Average Overflow
rp_army_of_the_dead Runic Power 1.00 30.00 (0.97%) 30.00 0.00 0.00%
rp_soul_reaper Runic Power 33.06 328.55 (10.65%) 9.94 2.00 0.61%
rp_plague_strike Runic Power 0.10 1.01 (0.03%) 9.96 0.00 0.40%
rp_scourge_strike Runic Power 137.97 1379.06 (44.69%) 10.00 0.61 0.04%
rp_festering_strike Runic Power 50.62 982.63 (31.84%) 19.41 29.76 2.94%
rp_empower_rune_weapon Runic Power 1.95 48.78 (1.58%) 25.00 0.00 0.00%
antimagic_shell Runic Power 8.00 315.70 (10.23%) 39.48 12.17 3.71%
rune_regen_all None 4052.40 211.01 (50.00%) 0.05 4.72 2.19%
rune_regen_unholy None 1353.31 71.73 (17.00%) 0.05 0.24 0.33%
rune_regen_blood None 1349.74 69.94 (16.57%) 0.05 1.97 2.75%
rune_regen_frost None 1349.35 69.34 (16.43%) 0.05 2.51 3.49%
empower_rune_weapon Rune 1.95 6.78 (5.92%) 3.47 4.93 42.10%
blood_tap Rune 53.84 53.84 (47.04%) 1.00 0.00 0.00%
blood_tap_blood Rune 24.13 24.13 (21.08%) 1.00 0.00 0.00%
blood_tap_frost Rune 24.17 24.17 (21.12%) 1.00 0.00 0.00%
blood_tap_unholy Rune 5.55 5.55 (4.84%) 1.00 0.00 0.00%
pet - ghoul
energy_regen Energy 909.84 6777.80 (100.00%) 7.45 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 67.00 663.02 (100.00%) 9.90 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 67.00 663.02 (100.00%) 9.90 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 67.00 663.02 (100.00%) 9.90 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 67.00 663.02 (100.00%) 9.90 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 67.00 663.02 (100.00%) 9.90 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 67.00 663.02 (100.00%) 9.90 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 67.00 663.02 (100.00%) 9.90 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 67.00 663.02 (100.00%) 9.90 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 6.86 6.78
Combat End Resource Mean Min Max
Runic Power 33.12 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 1.7%

Procs

Count Interval
Army of the Dead: Blood 1.0 0.0sec
Army of the Dead: Frost 1.0 0.0sec
Army of the Dead: Unholy 1.0 0.0sec
Soul Reaper: Unholy 9.0 18.8sec
Soul Reaper: Death 24.0 8.8sec
Plague Strike: Unholy 0.0 194.2sec
Plague Strike: Death 0.1 174.8sec
Scourge Strike: Unholy 65.7 6.8sec
Scourge Strike: Death 72.3 5.9sec
Festering Strike: Blood 35.9 12.6sec
Festering Strike: Frost 35.6 12.7sec
Festering Strike: Death 29.7 18.9sec
Blood runes ready 95.6 4.8sec
Frost runes ready 95.1 4.8sec
Unholy runes ready 79.4 5.8sec

Statistics & Data Analysis

Fight Length
Sample Data Shaque Fight Length
Count 24999
Mean 450.01
Minimum 351.82
Maximum 558.10
Spread ( max - min ) 206.27
Range [ ( max - min ) / 2 * 100% ] 22.92%
DPS
Sample Data Shaque Damage Per Second
Count 24999
Mean 89094.79
Minimum 81441.02
Maximum 102129.09
Spread ( max - min ) 20688.08
Range [ ( max - min ) / 2 * 100% ] 11.61%
Standard Deviation 2417.6841
5th Percentile 85383.89
95th Percentile 93267.27
( 95th Percentile - 5th Percentile ) 7883.38
Mean Distribution
Standard Deviation 15.2911
95.00% Confidence Intervall ( 89064.82 - 89124.76 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2828
0.1 Scale Factor Error with Delta=300 49897
0.05 Scale Factor Error with Delta=300 199591
0.01 Scale Factor Error with Delta=300 4989795
Priority Target DPS
Sample Data Shaque Priority Target Damage Per Second
Count 24999
Mean 89094.79
Minimum 81441.02
Maximum 102129.09
Spread ( max - min ) 20688.08
Range [ ( max - min ) / 2 * 100% ] 11.61%
Standard Deviation 2417.6841
5th Percentile 85383.89
95th Percentile 93267.27
( 95th Percentile - 5th Percentile ) 7883.38
Mean Distribution
Standard Deviation 15.2911
95.00% Confidence Intervall ( 89064.82 - 89124.76 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2828
0.1 Scale Factor Error with Delta=300 49897
0.05 Scale Factor Error with Delta=300 199591
0.01 Scale Factor Error with Delta=300 4989795
DPS(e)
Sample Data Shaque Damage Per Second (Effective)
Count 24999
Mean 89094.79
Minimum 81441.02
Maximum 102129.09
Spread ( max - min ) 20688.08
Range [ ( max - min ) / 2 * 100% ] 11.61%
Damage
Sample Data Shaque Damage
Count 24999
Mean 33906365.32
Minimum 25045679.57
Maximum 43522491.31
Spread ( max - min ) 18476811.73
Range [ ( max - min ) / 2 * 100% ] 27.25%
DTPS
Sample Data Shaque Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaque Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Shaque Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaque Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaque Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaque Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ShaqueTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Shaque Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=salty_squid_roll
2 0.00 horn_of_winter
3 0.00 unholy_presence
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 army_of_the_dead
6 0.00 potion,name=draenic_strength
7 0.00 raise_dead
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_attack
0.00 deaths_advance,if=movement.remains>2
9 8.00 antimagic_shell,damage=100000,if=((dot.breath_of_sindragosa.ticking&runic_power<25)|cooldown.breath_of_sindragosa.remains>40)|!talent.breath_of_sindragosa.enabled
0.00 blood_fury,if=!talent.breath_of_sindragosa.enabled
0.00 berserking,if=!talent.breath_of_sindragosa.enabled
0.00 arcane_torrent,if=!talent.breath_of_sindragosa.enabled
A 4.36 use_item,slot=finger1,if=!talent.breath_of_sindragosa.enabled
B 1.00 potion,name=draenic_strength,if=(buff.dark_transformation.up&target.time_to_die<=60)&!talent.breath_of_sindragosa.enabled
C 0.00 run_action_list,name=unholy
actions.unholy
# count action,conditions
0.00 plague_leech,if=((cooldown.outbreak.remains<1)|disease.min_remains<1)&((blood<1&frost<1)|(blood<1&unholy<1)|(frost<1&unholy<1))
D 33.06 soul_reaper,if=(target.health.pct-3*(target.health.pct%target.time_to_die))<=45
E 18.81 blood_tap,if=((target.health.pct-3*(target.health.pct%target.time_to_die))<=45)&cooldown.soul_reaper.remains=0
F 3.03 summon_gargoyle
0.00 breath_of_sindragosa,if=runic_power>75
G 0.00 run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
H 4.92 unholy_blight,if=!disease.min_ticking
0.00 outbreak,cycle_targets=1,if=!talent.necrotic_plague.enabled&(!(dot.blood_plague.ticking|dot.frost_fever.ticking))
I 0.10 plague_strike,if=(!talent.necrotic_plague.enabled&!(dot.blood_plague.ticking|dot.frost_fever.ticking))|(talent.necrotic_plague.enabled&!dot.necrotic_plague.ticking)
0.00 blood_boil,cycle_targets=1,if=(spell_targets.blood_boil>1&!talent.necrotic_plague.enabled)&(!(dot.blood_plague.ticking|dot.frost_fever.ticking))
0.00 death_and_decay,if=spell_targets.death_and_decay>1&unholy>1
0.00 defile,if=unholy=2
0.00 blood_tap,if=talent.defile.enabled&cooldown.defile.remains=0
J 3.76 scourge_strike,if=unholy=2
K 36.77 festering_strike,if=talent.necrotic_plague.enabled&talent.unholy_blight.enabled&dot.necrotic_plague.remains<cooldown.unholy_blight.remains%2
L 11.58 dark_transformation
M 1.71 festering_strike,if=blood=2&frost=2&(((Frost-death)>0)|((Blood-death)>0))
N 3.25 festering_strike,if=(blood=2|frost=2)&(((Frost-death)>0)&((Blood-death)>0))
0.00 blood_boil,cycle_targets=1,if=(talent.necrotic_plague.enabled&!dot.necrotic_plague.ticking)&spell_targets.blood_boil>1
0.00 defile,if=blood=2|frost=2
0.00 death_and_decay,if=spell_targets.death_and_decay>1
0.00 defile
0.00 blood_boil,if=talent.breath_of_sindragosa.enabled&((spell_targets.blood_boil>=4&(blood=2|(frost=2&death=2)))&(cooldown.breath_of_sindragosa.remains>6|runic_power<75))
0.00 blood_boil,if=!talent.breath_of_sindragosa.enabled&(spell_targets.blood_boil>=4&(blood=2|(frost=2&death=2)))
O 35.03 blood_tap,if=buff.blood_charge.stack>10
P 5.23 outbreak,if=talent.necrotic_plague.enabled&debuff.necrotic_plague.stack<=14
Q 40.93 death_coil,if=(buff.sudden_doom.react|runic_power>80)&(buff.blood_charge.stack<=10)
0.00 blood_boil,if=(spell_targets.blood_boil>=4&(cooldown.breath_of_sindragosa.remains>6|runic_power<75))|(!talent.breath_of_sindragosa.enabled&spell_targets.blood_boil>=4)
R 134.21 scourge_strike,if=(cooldown.breath_of_sindragosa.remains>6|runic_power<75|unholy=2)|!talent.breath_of_sindragosa.enabled
S 8.90 festering_strike,if=(cooldown.breath_of_sindragosa.remains>6|runic_power<75)|!talent.breath_of_sindragosa.enabled
T 96.55 death_coil,if=(cooldown.breath_of_sindragosa.remains>20)|!talent.breath_of_sindragosa.enabled
0.00 plague_leech
U 1.95 empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled

Sample Sequence

012356789AFHJKKPQQJKQLQKJQRTORRRRKQRTORTSRTTORRRTUJMQRORRQRRRQRRTLOQNRRQORTTR9RTORRQQOQJRKQQORSQRTORRTRTTORRTLRTORNTRSRTRTORRHPRRTKTORRQKRTAT9ORTLKRQORQTKQOQRRTORKRTTKTORRQRRRQORTTKQLORRTKRTORRRTRKTF9TORRNRQTORTRRTRHPKTLOKRTTKORTRRRQTORRTRTOKTRKTTORRRRTRRTOKAD9TLTKTDORRRTDTORTKREDTSQTDRREDTKRDTRREDQHLPKDQQQOKTDKTT9ORTDKTORTTDKTORTTDORRTEDKRTTLEDSRRTTEDQRRTTEDUJMRRQTEDRRRTTEDRKTFAD9SQRTTEDLRRRTEDRTSDTBSTEDRRHPQDRKQTQEDTKRTLEDRRTEDQKRRTTEDQRK9QTEDTKRTTEDRKTEDRTK

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 0.0/100: 0% runic_power
Pre food Fluffy_Pillow 0.0/100: 0% runic_power
Pre horn_of_winter Fluffy_Pillow 0.0/100: 0% runic_power
Pre unholy_presence Fluffy_Pillow 0.0/100: 0% runic_power
Pre army_of_the_dead Fluffy_Pillow 25.0/100: 25% runic_power
Pre potion Fluffy_Pillow 25.0/100: 25% runic_power draenic_strength_potion
Pre raise_dead Fluffy_Pillow 25.0/100: 25% runic_power draenic_strength_potion
0:00.000 auto_attack Fluffy_Pillow 25.0/100: 25% runic_power draenic_strength_potion
0:00.000 antimagic_shell Shaque 25.0/100: 25% runic_power unholy_strength, hammering_blows, draenic_strength_potion
0:00.000 use_item_thorasus_the_stone_heart_of_draenor Fluffy_Pillow 66.0/100: 66% runic_power unholy_strength, hammering_blows, draenic_strength_potion
0:00.000 summon_gargoyle Fluffy_Pillow 66.0/100: 66% runic_power unholy_strength, thorasus, hammering_blows, draenic_strength_potion
0:01.005 unholy_blight Fluffy_Pillow 66.0/100: 66% runic_power bloodlust, unholy_strength, thorasus, hammering_blows, draenic_strength_potion
0:02.010 scourge_strike Fluffy_Pillow 66.0/100: 66% runic_power bloodlust, unholy_strength, thorasus, hammering_blows(3), draenic_strength_potion
0:03.014 festering_strike Fluffy_Pillow 76.0/100: 76% runic_power bloodlust, unholy_strength, thorasus, hammering_blows(6), draenic_strength_potion
0:04.018 festering_strike Fluffy_Pillow 96.0/100: 96% runic_power bloodlust, sudden_doom, unholy_strength, thorasus, hammering_blows(9), draenic_strength_potion
0:05.022 outbreak Fluffy_Pillow 100.0/100: 100% runic_power bloodlust, sudden_doom, unholy_strength, thorasus, hammering_blows(11), draenic_strength_potion
0:06.027 death_coil Fluffy_Pillow 100.0/100: 100% runic_power bloodlust, sudden_doom, unholy_strength, thorasus, hammering_blows(15), draenic_strength_potion
0:07.032 death_coil Fluffy_Pillow 100.0/100: 100% runic_power bloodlust, blood_charge(2), shadow_infusion(2), unholy_strength, thorasus, hammering_blows(17), draenic_strength_potion
0:08.036 scourge_strike Fluffy_Pillow 70.0/100: 70% runic_power bloodlust, blood_charge(4), shadow_infusion(4), unholy_strength, thorasus, hammering_blows(20), draenic_strength_potion
0:09.040 festering_strike Fluffy_Pillow 80.0/100: 80% runic_power bloodlust, blood_charge(4), shadow_infusion(4), unholy_strength, thorasus, hammering_blows(20), draenic_strength_potion
0:10.043 death_coil Fluffy_Pillow 100.0/100: 100% runic_power bloodlust, blood_charge(4), sudden_doom, shadow_infusion(4), unholy_strength, thorasus, hammering_blows(20), draenic_strength_potion
0:11.047 dark_transformation Fluffy_Pillow 100.0/100: 100% runic_power bloodlust, blood_charge(6), shadow_infusion(5), unholy_strength, thorasus, hammering_blows(20), draenic_strength_potion
0:12.051 death_coil Fluffy_Pillow 100.0/100: 100% runic_power bloodlust, blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, thorasus, hammering_blows(20), draenic_strength_potion
0:13.056 festering_strike Fluffy_Pillow 70.0/100: 70% runic_power bloodlust, blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, thorasus, hammering_blows(20), draenic_strength_potion
0:14.060 scourge_strike Fluffy_Pillow 90.0/100: 90% runic_power bloodlust, blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, thorasus, hammering_blows(20), draenic_strength_potion
0:15.063 death_coil Fluffy_Pillow 100.0/100: 100% runic_power bloodlust, blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20), draenic_strength_potion
0:16.067 scourge_strike Fluffy_Pillow 70.0/100: 70% runic_power bloodlust, blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20), draenic_strength_potion
0:17.072 death_coil Fluffy_Pillow 80.0/100: 80% runic_power bloodlust, blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20), draenic_strength_potion
0:18.078 blood_tap Fluffy_Pillow 50.0/100: 50% runic_power bloodlust, blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20), draenic_strength_potion
0:18.078 scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power bloodlust, blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20), draenic_strength_potion
0:19.083 scourge_strike Fluffy_Pillow 60.0/100: 60% runic_power bloodlust, blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20), draenic_strength_potion
0:20.087 scourge_strike Fluffy_Pillow 70.0/100: 70% runic_power bloodlust, blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, draenic_strength_potion
0:21.090 scourge_strike Fluffy_Pillow 80.0/100: 80% runic_power bloodlust, blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(2), draenic_strength_potion
0:22.095 festering_strike Fluffy_Pillow 90.0/100: 90% runic_power bloodlust, blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(4), draenic_strength_potion
0:23.098 death_coil Fluffy_Pillow 100.0/100: 100% runic_power bloodlust, blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(5)
0:24.103 scourge_strike Fluffy_Pillow 70.0/100: 70% runic_power bloodlust, blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(7)
0:25.106 death_coil Fluffy_Pillow 80.0/100: 80% runic_power bloodlust, blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(8)
0:26.111 blood_tap Fluffy_Pillow 50.0/100: 50% runic_power bloodlust, blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(10)
0:26.111 scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power bloodlust, blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(10)
0:27.115 death_coil Fluffy_Pillow 60.0/100: 60% runic_power bloodlust, blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(12)
0:28.120 festering_strike Fluffy_Pillow 30.0/100: 30% runic_power bloodlust, blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(13)
0:29.126 scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power bloodlust, blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(15)
0:30.131 death_coil Fluffy_Pillow 60.0/100: 60% runic_power bloodlust, blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(16)
0:31.134 death_coil Fluffy_Pillow 30.0/100: 30% runic_power bloodlust, blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(18)
0:32.138 blood_tap Fluffy_Pillow 0.0/100: 0% runic_power bloodlust, blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
0:32.138 scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power bloodlust, blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
0:33.144 scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power bloodlust, blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
0:34.149 scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power bloodlust, blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
0:35.152 death_coil Fluffy_Pillow 30.0/100: 30% runic_power bloodlust, blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
0:36.155 empower_rune_weapon Fluffy_Pillow 0.0/100: 0% runic_power bloodlust, blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
0:36.155 scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power bloodlust, blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
0:37.159 festering_strike Fluffy_Pillow 35.0/100: 35% runic_power bloodlust, blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
0:38.165 death_coil Fluffy_Pillow 55.0/100: 55% runic_power bloodlust, blood_charge(9), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, hammering_blows(20)
0:39.169 scourge_strike Fluffy_Pillow 55.0/100: 55% runic_power bloodlust, blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
0:40.173 blood_tap Fluffy_Pillow 65.0/100: 65% runic_power bloodlust, blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity
0:40.173 scourge_strike Fluffy_Pillow 65.0/100: 65% runic_power bloodlust, blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
0:41.176 scourge_strike Fluffy_Pillow 75.0/100: 75% runic_power blood_charge(6), unholy_strength
0:42.180 death_coil Fluffy_Pillow 85.0/100: 85% runic_power blood_charge(6), unholy_strength
0:43.185 scourge_strike Fluffy_Pillow 55.0/100: 55% runic_power blood_charge(8), shadow_infusion(2), unholy_strength
0:44.189 scourge_strike Fluffy_Pillow 65.0/100: 65% runic_power blood_charge(8), shadow_infusion(2), unholy_strength
0:45.193 scourge_strike Fluffy_Pillow 75.0/100: 75% runic_power blood_charge(8), shadow_infusion(2), unholy_strength
0:46.198 death_coil Fluffy_Pillow 85.0/100: 85% runic_power blood_charge(8), shadow_infusion(2)
0:47.202 scourge_strike Fluffy_Pillow 55.0/100: 55% runic_power blood_charge(10), shadow_infusion(4)
0:48.207 scourge_strike Fluffy_Pillow 65.0/100: 65% runic_power blood_charge(10), shadow_infusion(4)
0:49.211 death_coil Fluffy_Pillow 75.0/100: 75% runic_power blood_charge(10), shadow_infusion(4)
0:50.214 dark_transformation Fluffy_Pillow 45.0/100: 45% runic_power blood_charge(12), sudden_doom, shadow_infusion(5), unholy_strength
0:51.218 blood_tap Fluffy_Pillow 45.0/100: 45% runic_power blood_charge(12), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
0:51.218 death_coil Fluffy_Pillow 45.0/100: 45% runic_power blood_charge(7), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
0:52.224 festering_strike Fluffy_Pillow 45.0/100: 45% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
0:53.228 scourge_strike Fluffy_Pillow 65.0/100: 65% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
0:54.232 scourge_strike Fluffy_Pillow 75.0/100: 75% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
0:55.235 death_coil Fluffy_Pillow 85.0/100: 85% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
0:56.238 blood_tap Fluffy_Pillow 55.0/100: 55% runic_power blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity
0:56.238 scourge_strike Fluffy_Pillow 55.0/100: 55% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
0:57.245 death_coil Fluffy_Pillow 65.0/100: 65% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
0:58.247 death_coil Fluffy_Pillow 35.0/100: 35% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
0:59.253 scourge_strike Fluffy_Pillow 5.0/100: 5% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity
1:00.257 antimagic_shell Shaque 15.0/100: 15% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity
1:00.257 scourge_strike Fluffy_Pillow 56.0/100: 56% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity
1:01.262 death_coil Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(10), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
1:02.267 blood_tap Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity
1:02.267 scourge_strike Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
1:03.272 scourge_strike Fluffy_Pillow 76.0/100: 76% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
1:04.276 death_coil Fluffy_Pillow 86.0/100: 86% runic_power blood_charge(7), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
1:05.281 death_coil Fluffy_Pillow 86.0/100: 86% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
1:06.285 blood_tap Fluffy_Pillow 56.0/100: 56% runic_power blood_charge(11), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
1:06.285 death_coil Fluffy_Pillow 56.0/100: 56% runic_power blood_charge(6), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
1:07.289 scourge_strike Fluffy_Pillow 56.0/100: 56% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
1:08.295 scourge_strike Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
1:09.300 festering_strike Fluffy_Pillow 76.0/100: 76% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
1:10.304 death_coil Fluffy_Pillow 96.0/100: 96% runic_power blood_charge(8), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, hammering_blows
1:11.308 death_coil Fluffy_Pillow 96.0/100: 96% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(2)
1:12.314 blood_tap Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(4)
1:12.314 scourge_strike Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(4)
1:13.319 festering_strike Fluffy_Pillow 76.0/100: 76% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(5)
1:14.323 death_coil Fluffy_Pillow 96.0/100: 96% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(6)
1:15.327 scourge_strike Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(8)
1:16.330 death_coil Fluffy_Pillow 76.0/100: 76% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(9)
1:17.335 blood_tap Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(11)
1:17.335 scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(11)
1:18.340 scourge_strike Fluffy_Pillow 56.0/100: 56% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(12)
1:19.346 death_coil Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(14)
1:20.351 scourge_strike Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(8), unholy_strength, hammering_blows(15)
1:21.356 death_coil Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(8), sudden_doom, unholy_strength, hammering_blows(17)
1:22.361 death_coil Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(10), shadow_infusion(2), unholy_strength, hammering_blows(18)
1:23.366 blood_tap Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(12), shadow_infusion(4), unholy_strength, hammering_blows(19)
1:23.366 scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(7), shadow_infusion(4), unholy_strength, hammering_blows(19)
1:24.370 scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(7), shadow_infusion(4), unholy_strength, hammering_blows(20)
1:25.377 death_coil Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(7), shadow_infusion(4), unholy_strength, hammering_blows(20)
1:26.380 dark_transformation Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(9), shadow_infusion(5), unholy_strength, hammering_blows(20)
1:27.384 scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:28.389 Waiting 0.200 sec 16.0/100: 16% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:28.589 death_coil Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(9), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:29.593 blood_tap Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:29.593 scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:30.598 festering_strike Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:31.602 death_coil Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:32.607 scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:33.613 Waiting 3.200 sec 26.0/100: 26% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(20)
1:36.813 festering_strike Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(20)
1:37.817 scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(20)
1:38.823 death_coil Fluffy_Pillow 56.0/100: 56% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(20)
1:39.828 scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(10), dark_transformation, crazed_monstrosity, hammering_blows(20)
1:40.831 death_coil Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(10), dark_transformation, crazed_monstrosity, hammering_blows(20)
1:41.836 blood_tap Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(12), dark_transformation, crazed_monstrosity, hammering_blows(20)
1:41.836 scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(7), dark_transformation, crazed_monstrosity, hammering_blows(20)
1:42.839 Waiting 0.700 sec 16.0/100: 16% runic_power blood_charge(7), dark_transformation, crazed_monstrosity, hammering_blows(20)
1:43.539 scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(7), dark_transformation, crazed_monstrosity, hammering_blows(20)
1:44.544 unholy_blight Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:45.549 outbreak Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:46.554 scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
1:47.560 scourge_strike Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
1:48.564 death_coil Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
1:49.568 Waiting 0.800 sec 16.0/100: 16% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
1:50.368 festering_strike Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
1:51.373 death_coil Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
1:52.379 blood_tap Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity
1:52.379 scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
1:53.384 scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(6), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
1:54.389 death_coil Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(6), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
1:55.395 Waiting 1.700 sec 26.0/100: 26% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
1:57.095 festering_strike Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(8), unholy_strength
1:58.101 scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(8), unholy_strength
1:59.105 death_coil Fluffy_Pillow 56.0/100: 56% runic_power blood_charge(8), unholy_strength
2:00.109 use_item_thorasus_the_stone_heart_of_draenor Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(10), sudden_doom, shadow_infusion(2), unholy_strength
2:00.109 death_coil Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(10), sudden_doom, shadow_infusion(2), unholy_strength, thorasus
2:01.115 antimagic_shell Shaque 26.0/100: 26% runic_power blood_charge(12), shadow_infusion(4), unholy_strength, thorasus
2:01.115 blood_tap Fluffy_Pillow 67.0/100: 67% runic_power blood_charge(12), shadow_infusion(4), unholy_strength, thorasus
2:01.115 scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power blood_charge(7), shadow_infusion(4), unholy_strength, thorasus
2:02.119 death_coil Fluffy_Pillow 77.0/100: 77% runic_power blood_charge(7), shadow_infusion(4), thorasus
2:03.122 dark_transformation Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(9), shadow_infusion(5), unholy_strength, thorasus
2:04.127 festering_strike Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
2:05.132 scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power blood_charge(9), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, thorasus
2:06.136 death_coil Fluffy_Pillow 77.0/100: 77% runic_power blood_charge(9), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, thorasus
2:07.141 blood_tap Fluffy_Pillow 77.0/100: 77% runic_power blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
2:07.141 scourge_strike Fluffy_Pillow 77.0/100: 77% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
2:08.145 death_coil Fluffy_Pillow 87.0/100: 87% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
2:09.151 death_coil Fluffy_Pillow 57.0/100: 57% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
2:10.154 festering_strike Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(10), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, thorasus
2:11.159 death_coil Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(10), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, thorasus
2:12.165 blood_tap Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(12), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, thorasus
2:12.165 death_coil Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(7), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, thorasus
2:13.169 scourge_strike Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
2:14.173 scourge_strike Fluffy_Pillow 57.0/100: 57% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
2:15.177 death_coil Fluffy_Pillow 67.0/100: 67% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
2:16.181 blood_tap Fluffy_Pillow 37.0/100: 37% runic_power blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity
2:16.181 scourge_strike Fluffy_Pillow 37.0/100: 37% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
2:17.185 festering_strike Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
2:18.189 scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
2:19.194 death_coil Fluffy_Pillow 77.0/100: 77% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
2:20.198 death_coil Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(8), dark_transformation, crazed_monstrosity
2:21.203 Waiting 1.200 sec 17.0/100: 17% runic_power blood_charge(10), dark_transformation, crazed_monstrosity
2:22.403 festering_strike Fluffy_Pillow 17.0/100: 17% runic_power blood_charge(10), dark_transformation, crazed_monstrosity
2:23.407 death_coil Fluffy_Pillow 37.0/100: 37% runic_power blood_charge(10), dark_transformation, crazed_monstrosity
2:24.413 blood_tap Fluffy_Pillow 7.0/100: 7% runic_power blood_charge(12), dark_transformation, crazed_monstrosity
2:24.413 scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power blood_charge(7), dark_transformation, crazed_monstrosity
2:25.417 scourge_strike Fluffy_Pillow 17.0/100: 17% runic_power blood_charge(7), dark_transformation, sudden_doom, crazed_monstrosity
2:26.422 death_coil Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(7), dark_transformation, sudden_doom, crazed_monstrosity
2:27.426 Waiting 1.700 sec 27.0/100: 27% runic_power blood_charge(9), dark_transformation, crazed_monstrosity
2:29.126 scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(9), dark_transformation, crazed_monstrosity
2:30.130 scourge_strike Fluffy_Pillow 37.0/100: 37% runic_power blood_charge(9), dark_transformation, sudden_doom, crazed_monstrosity
2:31.133 scourge_strike Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(9), dark_transformation, sudden_doom, crazed_monstrosity
2:32.138 death_coil Fluffy_Pillow 57.0/100: 57% runic_power blood_charge(9), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
2:33.142 blood_tap Fluffy_Pillow 57.0/100: 57% runic_power blood_charge(11), unholy_strength
2:33.142 scourge_strike Fluffy_Pillow 57.0/100: 57% runic_power blood_charge(6), unholy_strength
2:34.147 death_coil Fluffy_Pillow 67.0/100: 67% runic_power blood_charge(6), unholy_strength
2:35.152 death_coil Fluffy_Pillow 37.0/100: 37% runic_power blood_charge(8), shadow_infusion(2), unholy_strength
2:36.155 festering_strike Fluffy_Pillow 7.0/100: 7% runic_power blood_charge(10), shadow_infusion(4), unholy_strength
2:37.160 death_coil Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(10), sudden_doom, shadow_infusion(4), unholy_strength
2:38.165 dark_transformation Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(12), shadow_infusion(5), unholy_strength
2:39.168 blood_tap Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity
2:39.168 scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
2:40.174 scourge_strike Fluffy_Pillow 37.0/100: 37% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
2:41.178 death_coil Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
2:42.182 Waiting 0.500 sec 17.0/100: 17% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
2:42.682 festering_strike Fluffy_Pillow 17.0/100: 17% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
2:43.686 scourge_strike Fluffy_Pillow 37.0/100: 37% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
2:44.692 death_coil Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
2:45.698 blood_tap Fluffy_Pillow 17.0/100: 17% runic_power blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity
2:45.698 scourge_strike Fluffy_Pillow 17.0/100: 17% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
2:46.702 Waiting 2.500 sec 27.0/100: 27% runic_power blood_charge(6), dark_transformation, crazed_monstrosity
2:49.202 scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(6), dark_transformation, crazed_monstrosity
2:50.206 scourge_strike Fluffy_Pillow 37.0/100: 37% runic_power blood_charge(6), dark_transformation, crazed_monstrosity
2:51.211 death_coil Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(6), dark_transformation, crazed_monstrosity
2:52.215 Waiting 3.800 sec 17.0/100: 17% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
2:56.015 scourge_strike Fluffy_Pillow 17.0/100: 17% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
2:57.018 festering_strike Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
2:58.022 death_coil Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
2:59.026 Waiting 1.000 sec 17.0/100: 17% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity
3:00.026 summon_gargoyle Fluffy_Pillow 17.0/100: 17% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity
3:01.031 Waiting 0.100 sec 17.0/100: 17% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity
3:01.131 antimagic_shell Shaque 17.0/100: 17% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity
3:01.131 death_coil Fluffy_Pillow 58.0/100: 58% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity
3:02.137 blood_tap Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity
3:02.137 scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
3:03.140 scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
3:04.145 festering_strike Fluffy_Pillow 48.0/100: 48% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
3:05.150 scourge_strike Fluffy_Pillow 68.0/100: 68% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
3:06.155 death_coil Fluffy_Pillow 78.0/100: 78% runic_power blood_charge(7), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
3:07.160 death_coil Fluffy_Pillow 78.0/100: 78% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
3:08.164 blood_tap Fluffy_Pillow 48.0/100: 48% runic_power blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity
3:08.164 scourge_strike Fluffy_Pillow 48.0/100: 48% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
3:09.168 death_coil Fluffy_Pillow 58.0/100: 58% runic_power blood_charge(6), unholy_strength
3:10.173 scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(8), shadow_infusion(2), unholy_strength
3:11.177 scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(8), shadow_infusion(2), unholy_strength
3:12.184 death_coil Fluffy_Pillow 48.0/100: 48% runic_power blood_charge(8), shadow_infusion(2), unholy_strength
3:13.187 Waiting 2.300 sec 18.0/100: 18% runic_power blood_charge(10), shadow_infusion(4), unholy_strength
3:15.487 scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(10), shadow_infusion(4), unholy_strength
3:16.491 unholy_blight Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(10), shadow_infusion(4)
3:17.495 outbreak Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(10), shadow_infusion(4)
3:18.498 festering_strike Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(10), shadow_infusion(4)
3:19.502 death_coil Fluffy_Pillow 48.0/100: 48% runic_power blood_charge(10), shadow_infusion(4)
3:20.508 dark_transformation Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(12), shadow_infusion(5)
3:21.513 blood_tap Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(12), dark_transformation, crazed_monstrosity
3:21.513 festering_strike Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(7), dark_transformation, crazed_monstrosity
3:22.519 scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(7), dark_transformation, crazed_monstrosity
3:23.523 death_coil Fluffy_Pillow 48.0/100: 48% runic_power blood_charge(7), dark_transformation, crazed_monstrosity
3:24.529 Waiting 0.100 sec 18.0/100: 18% runic_power blood_charge(9), dark_transformation, crazed_monstrosity, hammering_blows
3:24.629 death_coil Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(9), dark_transformation, sudden_doom, crazed_monstrosity, hammering_blows(2)
3:25.633 festering_strike Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(11), dark_transformation, crazed_monstrosity, hammering_blows(4)
3:26.635 blood_tap Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(11), dark_transformation, crazed_monstrosity, hammering_blows(6)
3:26.635 scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(6), dark_transformation, crazed_monstrosity, hammering_blows(6)
3:27.641 death_coil Fluffy_Pillow 48.0/100: 48% runic_power blood_charge(6), dark_transformation, crazed_monstrosity, hammering_blows(8)
3:28.645 scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(9)
3:29.649 Waiting 0.800 sec 28.0/100: 28% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(11)
3:30.449 scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(11)
3:31.453 scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(8), dark_transformation, sudden_doom, crazed_monstrosity, hammering_blows(13)
3:32.458 death_coil Fluffy_Pillow 48.0/100: 48% runic_power blood_charge(8), dark_transformation, sudden_doom, crazed_monstrosity, hammering_blows(14)
3:33.463 death_coil Fluffy_Pillow 48.0/100: 48% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(16)
3:34.467 blood_tap Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(17)
3:34.467 scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(17)
3:35.472 scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(18)
3:36.475 death_coil Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
3:37.481 scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
3:38.486 death_coil Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(9), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, hammering_blows(20)
3:39.490 blood_tap Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
3:39.490 festering_strike Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
3:40.495 death_coil Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
3:41.500 scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
3:42.503 Waiting 1.900 sec 18.0/100: 18% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
3:44.403 festering_strike Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
3:45.406 death_coil Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
3:46.411 Waiting 0.500 sec 8.0/100: 8% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity
3:46.911 death_coil Fluffy_Pillow 8.0/100: 8% runic_power blood_charge(10), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
3:47.916 blood_tap Fluffy_Pillow 8.0/100: 8% runic_power blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity
3:47.916 scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
3:48.922 scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
3:49.926 Waiting 0.800 sec 28.0/100: 28% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
3:50.726 scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(7), unholy_strength
3:51.730 scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(7), unholy_strength
3:52.735 death_coil Fluffy_Pillow 48.0/100: 48% runic_power blood_charge(7), unholy_strength
3:53.740 scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power blood_charge(9), shadow_infusion(2), unholy_strength, hammering_blows
3:54.744 Waiting 2.700 sec 28.0/100: 28% runic_power blood_charge(9), shadow_infusion(2), unholy_strength, hammering_blows(3)
3:57.444 scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(9), shadow_infusion(2), unholy_strength, hammering_blows(4)
3:58.448 death_coil Fluffy_Pillow 38.0/100: 38% runic_power blood_charge(9), shadow_infusion(2), unholy_strength, hammering_blows(5)
3:59.454 blood_tap Fluffy_Pillow 8.0/100: 8% runic_power blood_charge(11), shadow_infusion(4), unholy_strength, hammering_blows(7)
3:59.454 festering_strike Fluffy_Pillow 8.0/100: 8% runic_power blood_charge(6), shadow_infusion(4), unholy_strength, hammering_blows(7)
4:00.455 use_item_thorasus_the_stone_heart_of_draenor Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(6), shadow_infusion(4), unholy_strength, hammering_blows(8)
4:00.455 soul_reaper Fluffy_Pillow 28.0/100: 28% runic_power blood_charge(6), shadow_infusion(4), unholy_strength, thorasus, hammering_blows(8)
4:01.457 antimagic_shell Shaque 38.0/100: 38% runic_power blood_charge(6), shadow_infusion(4), unholy_strength, thorasus, hammering_blows(10)
4:01.457 death_coil Fluffy_Pillow 79.0/100: 79% runic_power blood_charge(6), shadow_infusion(4), unholy_strength, thorasus, hammering_blows(10)
4:02.462 dark_transformation Fluffy_Pillow 49.0/100: 49% runic_power blood_charge(8), shadow_infusion(5), unholy_strength, thorasus, hammering_blows(11)
4:03.466 death_coil Fluffy_Pillow 49.0/100: 49% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, thorasus, hammering_blows(11)
4:04.471 festering_strike Fluffy_Pillow 19.0/100: 19% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity, thorasus, hammering_blows(13)
4:05.475 death_coil Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity, thorasus, hammering_blows(14)
4:06.482 soul_reaper Fluffy_Pillow 9.0/100: 9% runic_power blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity, thorasus, hammering_blows(16)
4:07.488 blood_tap Fluffy_Pillow 19.0/100: 19% runic_power blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity, thorasus, hammering_blows(17)
4:07.488 scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, thorasus, hammering_blows(17)
4:08.492 Waiting 1.700 sec 29.0/100: 29% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, thorasus, hammering_blows(19)
4:10.192 scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power blood_charge(7), dark_transformation, crazed_monstrosity, thorasus, hammering_blows(19)
4:11.199 scourge_strike Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(7), dark_transformation, crazed_monstrosity, thorasus, hammering_blows(20)
4:12.204 death_coil Fluffy_Pillow 49.0/100: 49% runic_power blood_charge(7), dark_transformation, crazed_monstrosity, thorasus, hammering_blows(20)
4:13.210 soul_reaper Fluffy_Pillow 19.0/100: 19% runic_power blood_charge(9), dark_transformation, crazed_monstrosity, thorasus
4:14.216 Waiting 0.500 sec 29.0/100: 29% runic_power blood_charge(9), dark_transformation, crazed_monstrosity, thorasus, hammering_blows
4:14.716 death_coil Fluffy_Pillow 29.0/100: 29% runic_power blood_charge(9), dark_transformation, sudden_doom, crazed_monstrosity, thorasus, hammering_blows(2)
4:15.722 blood_tap Fluffy_Pillow 29.0/100: 29% runic_power blood_charge(11), dark_transformation, crazed_monstrosity, hammering_blows(3)
4:15.722 scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power blood_charge(6), dark_transformation, crazed_monstrosity, hammering_blows(3)
4:16.726 death_coil Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(6), dark_transformation, crazed_monstrosity, hammering_blows(4)
4:17.729 festering_strike Fluffy_Pillow 9.0/100: 9% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(6)
4:18.731 Waiting 0.400 sec 29.0/100: 29% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(7)
4:19.131 scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(7)
4:20.135 blood_tap Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(8), dark_transformation, crazed_monstrosity, hammering_blows(9)
4:20.135 soul_reaper Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(3), dark_transformation, crazed_monstrosity, hammering_blows(9)
4:21.140 death_coil Fluffy_Pillow 49.0/100: 49% runic_power blood_charge(3), dark_transformation, crazed_monstrosity, hammering_blows(10)
4:22.144 Waiting 1.500 sec 19.0/100: 19% runic_power blood_charge(5), dark_transformation, crazed_monstrosity, hammering_blows(12)
4:23.644 festering_strike Fluffy_Pillow 19.0/100: 19% runic_power blood_charge(5), dark_transformation, sudden_doom, crazed_monstrosity, hammering_blows(13)
4:24.648 death_coil Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(5), dark_transformation, sudden_doom, crazed_monstrosity, hammering_blows(14)
4:25.654 death_coil Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(7), dark_transformation, crazed_monstrosity, hammering_blows(15)
4:26.661 soul_reaper Fluffy_Pillow 9.0/100: 9% runic_power blood_charge(9), dark_transformation, crazed_monstrosity, hammering_blows(17)
4:27.664 Waiting 2.700 sec 19.0/100: 19% runic_power blood_charge(9), dark_transformation, crazed_monstrosity, hammering_blows(18)
4:30.364 scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
4:31.369 Waiting 0.600 sec 29.0/100: 29% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
4:31.969 scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
4:32.973 blood_tap Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(9), unholy_strength, hammering_blows(20)
4:32.973 soul_reaper Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(4), unholy_strength, hammering_blows(20)
4:33.977 death_coil Fluffy_Pillow 49.0/100: 49% runic_power blood_charge(4), unholy_strength
4:34.979 Waiting 2.200 sec 19.0/100: 19% runic_power blood_charge(6), shadow_infusion(2), unholy_strength
4:37.179 festering_strike Fluffy_Pillow 19.0/100: 19% runic_power blood_charge(6), shadow_infusion(2), unholy_strength
4:38.184 scourge_strike Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(6), shadow_infusion(2), unholy_strength
4:39.190 soul_reaper Fluffy_Pillow 49.0/100: 49% runic_power blood_charge(6), shadow_infusion(2), unholy_strength
4:40.194 death_coil Fluffy_Pillow 59.0/100: 59% runic_power blood_charge(6), shadow_infusion(2), unholy_strength
4:41.198 Waiting 2.800 sec 29.0/100: 29% runic_power blood_charge(8), shadow_infusion(4), unholy_strength
4:43.998 scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power blood_charge(8), shadow_infusion(4), unholy_strength
4:45.003 scourge_strike Fluffy_Pillow 39.0/100: 39% runic_power blood_charge(8), sudden_doom, shadow_infusion(4), unholy_strength
4:46.006 blood_tap Fluffy_Pillow 49.0/100: 49% runic_power blood_charge(8), sudden_doom, shadow_infusion(4), unholy_strength
4:46.006 soul_reaper Fluffy_Pillow 49.0/100: 49% runic_power blood_charge(3), sudden_doom, shadow_infusion(4), unholy_strength
4:47.012 death_coil Fluffy_Pillow 59.0/100: 59% runic_power blood_charge(3), sudden_doom, shadow_infusion(4), unholy_strength
4:48.017 unholy_blight Fluffy_Pillow 59.0/100: 59% runic_power blood_charge(5), sudden_doom, shadow_infusion(5), unholy_strength
4:49.020 dark_transformation Fluffy_Pillow 59.0/100: 59% runic_power blood_charge(5), sudden_doom, shadow_infusion(5), unholy_strength
4:50.024 outbreak Fluffy_Pillow 59.0/100: 59% runic_power blood_charge(5), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
4:51.030 festering_strike Fluffy_Pillow 59.0/100: 59% runic_power blood_charge(5), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
4:52.036 soul_reaper Fluffy_Pillow 79.0/100: 79% runic_power blood_charge(5), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
4:53.040 death_coil Fluffy_Pillow 89.0/100: 89% runic_power blood_charge(5), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
4:54.044 death_coil Fluffy_Pillow 89.0/100: 89% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
4:55.049 death_coil Fluffy_Pillow 59.0/100: 59% runic_power blood_charge(9), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
4:56.053 blood_tap Fluffy_Pillow 59.0/100: 59% runic_power blood_charge(11), dark_transformation, unholy_strength, crazed_monstrosity
4:56.053 festering_strike Fluffy_Pillow 59.0/100: 59% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
4:57.058 death_coil Fluffy_Pillow 79.0/100: 79% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity
4:58.063 soul_reaper Fluffy_Pillow 49.0/100: 49% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
4:59.067 festering_strike Fluffy_Pillow 59.0/100: 59% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
5:00.072 death_coil Fluffy_Pillow 79.0/100: 79% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
5:01.077 death_coil Fluffy_Pillow 49.0/100: 49% runic_power blood_charge(10), dark_transformation, unholy_strength, crazed_monstrosity
5:02.082 antimagic_shell Shaque 19.0/100: 19% runic_power blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity
5:02.082 blood_tap Fluffy_Pillow 60.0/100: 60% runic_power blood_charge(12), dark_transformation, unholy_strength, crazed_monstrosity
5:02.082 scourge_strike Fluffy_Pillow 60.0/100: 60% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
5:03.086 death_coil Fluffy_Pillow 70.0/100: 70% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
5:04.090 soul_reaper Fluffy_Pillow 40.0/100: 40% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
5:05.094 festering_strike Fluffy_Pillow 50.0/100: 50% runic_power blood_charge(9), dark_transformation, unholy_strength, crazed_monstrosity
5:06.098 death_coil Fluffy_Pillow 70.0/100: 70% runic_power blood_charge(9), dark_transformation, crazed_monstrosity
5:07.105 blood_tap Fluffy_Pillow 40.0/100: 40% runic_power blood_charge(11), dark_transformation, crazed_monstrosity
5:07.105 scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power blood_charge(6), dark_transformation, crazed_monstrosity
5:08.111 death_coil Fluffy_Pillow 50.0/100: 50% runic_power blood_charge(6), dark_transformation, crazed_monstrosity
5:09.116 Waiting 0.700 sec 20.0/100: 20% runic_power blood_charge(8), dark_transformation, crazed_monstrosity
5:09.816 death_coil Fluffy_Pillow 20.0/100: 20% runic_power blood_charge(8), dark_transformation, sudden_doom, crazed_monstrosity
5:10.819 soul_reaper Fluffy_Pillow 20.0/100: 20% runic_power blood_charge(10), dark_transformation, crazed_monstrosity
5:11.825 festering_strike Fluffy_Pillow 30.0/100: 30% runic_power blood_charge(10), dark_transformation, crazed_monstrosity
5:12.828 death_coil Fluffy_Pillow 50.0/100: 50% runic_power blood_charge(10), dark_transformation, crazed_monstrosity
5:13.832 blood_tap Fluffy_Pillow 20.0/100: 20% runic_power blood_charge(12), dark_transformation, crazed_monstrosity
5:13.832 scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power blood_charge(7), dark_transformation, crazed_monstrosity
5:14.837 death_coil Fluffy_Pillow 30.0/100: 30% runic_power blood_charge(7), dark_transformation, sudden_doom, crazed_monstrosity
5:15.841 death_coil Fluffy_Pillow 30.0/100: 30% runic_power blood_charge(9), dark_transformation, crazed_monstrosity
5:16.844 soul_reaper Fluffy_Pillow 0.0/100: 0% runic_power blood_charge(11), dark_transformation, crazed_monstrosity
5:17.850 blood_tap Fluffy_Pillow 10.0/100: 10% runic_power blood_charge(11), dark_transformation, crazed_monstrosity
5:17.850 scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power blood_charge(6), dark_transformation, crazed_monstrosity
5:18.854 scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power blood_charge(6), dark_transformation, crazed_monstrosity
5:19.859 death_coil Fluffy_Pillow 30.0/100: 30% runic_power blood_charge(6)
5:20.864 Waiting 2.000 sec 0.0/100: 0% runic_power blood_charge(8), shadow_infusion(2)
5:22.864 blood_tap Fluffy_Pillow 0.0/100: 0% runic_power blood_charge(8), shadow_infusion(2), unholy_strength
5:22.864 soul_reaper Fluffy_Pillow 0.0/100: 0% runic_power blood_charge(3), shadow_infusion(2), unholy_strength
5:23.868 festering_strike Fluffy_Pillow 10.0/100: 10% runic_power blood_charge(3), shadow_infusion(2), unholy_strength, hammering_blows
5:24.873 scourge_strike Fluffy_Pillow 30.0/100: 30% runic_power blood_charge(3), shadow_infusion(2), unholy_strength, hammering_blows(2)
5:25.878 death_coil Fluffy_Pillow 40.0/100: 40% runic_power blood_charge(3), sudden_doom, shadow_infusion(2), unholy_strength, hammering_blows(4)
5:26.884 death_coil Fluffy_Pillow 40.0/100: 40% runic_power blood_charge(5), shadow_infusion(4), unholy_strength, hammering_blows(5)
5:27.890 dark_transformation Fluffy_Pillow 10.0/100: 10% runic_power blood_charge(7), shadow_infusion(5), unholy_strength, hammering_blows(6)
5:28.895 blood_tap Fluffy_Pillow 10.0/100: 10% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(7)
5:28.895 soul_reaper Fluffy_Pillow 10.0/100: 10% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(7)
5:29.899 festering_strike Fluffy_Pillow 20.0/100: 20% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(8)
5:30.905 scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(10)
5:31.910 scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(11)
5:32.915 death_coil Fluffy_Pillow 60.0/100: 60% runic_power blood_charge(2), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, hammering_blows(13)
5:33.919 death_coil Fluffy_Pillow 60.0/100: 60% runic_power blood_charge(4), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(14)
5:34.924 blood_tap Fluffy_Pillow 30.0/100: 30% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(15)
5:34.924 soul_reaper Fluffy_Pillow 30.0/100: 30% runic_power blood_charge, dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(15)
5:35.928 death_coil Fluffy_Pillow 40.0/100: 40% runic_power blood_charge, dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity, hammering_blows(17)
5:36.934 scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(18)
5:37.939 scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:38.943 death_coil Fluffy_Pillow 60.0/100: 60% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:39.947 death_coil Fluffy_Pillow 30.0/100: 30% runic_power blood_charge(5), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:40.953 blood_tap Fluffy_Pillow 0.0/100: 0% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:40.953 soul_reaper Fluffy_Pillow 0.0/100: 0% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:41.958 empower_rune_weapon Fluffy_Pillow 10.0/100: 10% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:41.958 scourge_strike Fluffy_Pillow 35.0/100: 35% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:42.965 festering_strike Fluffy_Pillow 45.0/100: 45% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:43.970 scourge_strike Fluffy_Pillow 65.0/100: 65% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:44.974 scourge_strike Fluffy_Pillow 75.0/100: 75% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:45.977 death_coil Fluffy_Pillow 85.0/100: 85% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:46.981 death_coil Fluffy_Pillow 55.0/100: 55% runic_power blood_charge(4), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:47.986 blood_tap Fluffy_Pillow 25.0/100: 25% runic_power blood_charge(6), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:47.986 soul_reaper Fluffy_Pillow 25.0/100: 25% runic_power blood_charge, dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:48.989 scourge_strike Fluffy_Pillow 35.0/100: 35% runic_power blood_charge, dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:49.994 scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power blood_charge, dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:50.998 scourge_strike Fluffy_Pillow 55.0/100: 55% runic_power blood_charge, dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:52.004 death_coil Fluffy_Pillow 65.0/100: 65% runic_power blood_charge, dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:53.008 death_coil Fluffy_Pillow 35.0/100: 35% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:54.013 blood_tap Fluffy_Pillow 5.0/100: 5% runic_power blood_charge(5), dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:54.013 soul_reaper Fluffy_Pillow 5.0/100: 5% runic_power dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:55.018 scourge_strike Fluffy_Pillow 15.0/100: 15% runic_power dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:56.021 festering_strike Fluffy_Pillow 25.0/100: 25% runic_power dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:57.024 death_coil Fluffy_Pillow 45.0/100: 45% runic_power dark_transformation, unholy_strength, crazed_monstrosity, hammering_blows(20)
5:58.028 Waiting 2.000 sec 15.0/100: 15% runic_power blood_charge(2), unholy_strength
6:00.028 summon_gargoyle Fluffy_Pillow 15.0/100: 15% runic_power blood_charge(2), unholy_strength
6:01.031 use_item_thorasus_the_stone_heart_of_draenor Fluffy_Pillow 15.0/100: 15% runic_power blood_charge(2), unholy_strength
6:01.031 Waiting 0.800 sec 15.0/100: 15% runic_power blood_charge(2), unholy_strength, thorasus
6:01.831 soul_reaper Fluffy_Pillow 15.0/100: 15% runic_power blood_charge(2), unholy_strength, thorasus
6:02.835 antimagic_shell Shaque 25.0/100: 25% runic_power blood_charge(2), unholy_strength, thorasus
6:02.835 festering_strike Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(2), unholy_strength, thorasus
6:03.840 death_coil Fluffy_Pillow 86.0/100: 86% runic_power blood_charge(2), unholy_strength, thorasus
6:04.845 scourge_strike Fluffy_Pillow 56.0/100: 56% runic_power blood_charge(4), shadow_infusion(2), unholy_strength, thorasus
6:05.849 death_coil Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(4), shadow_infusion(2), unholy_strength, thorasus
6:06.852 death_coil Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(6), shadow_infusion(4), unholy_strength, thorasus
6:07.857 blood_tap Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(8), shadow_infusion(5), unholy_strength, thorasus
6:07.857 soul_reaper Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(3), shadow_infusion(5), unholy_strength, thorasus
6:08.863 dark_transformation Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(3), shadow_infusion(5), unholy_strength, thorasus
6:09.868 scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
6:10.871 scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
6:11.875 scourge_strike Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
6:12.880 death_coil Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
6:13.886 blood_tap Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(5), dark_transformation, unholy_strength, crazed_monstrosity, thorasus
6:13.886 soul_reaper Fluffy_Pillow 16.0/100: 16% runic_power dark_transformation, unholy_strength, crazed_monstrosity, thorasus
6:14.890 Waiting 0.500 sec 26.0/100: 26% runic_power dark_transformation, unholy_strength, crazed_monstrosity, thorasus
6:15.390 scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power dark_transformation, unholy_strength, crazed_monstrosity, thorasus
6:16.395 death_coil Fluffy_Pillow 36.0/100: 36% runic_power dark_transformation, unholy_strength, crazed_monstrosity
6:17.400 festering_strike Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity
6:18.408 Waiting 3.700 sec 26.0/100: 26% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity
6:22.108 soul_reaper Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(2), dark_transformation, crazed_monstrosity
6:23.113 death_coil Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(2), dark_transformation, crazed_monstrosity
6:24.117 potion Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(4), dark_transformation, crazed_monstrosity
6:24.117 festering_strike Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(4), dark_transformation, crazed_monstrosity, draenic_strength_potion
6:25.120 death_coil Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(4), dark_transformation, sudden_doom, crazed_monstrosity, draenic_strength_potion
6:26.125 Waiting 2.000 sec 26.0/100: 26% runic_power blood_charge(6), dark_transformation, crazed_monstrosity, draenic_strength_potion
6:28.125 blood_tap Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(6), dark_transformation, crazed_monstrosity, draenic_strength_potion
6:28.125 soul_reaper Fluffy_Pillow 26.0/100: 26% runic_power blood_charge, dark_transformation, crazed_monstrosity, draenic_strength_potion
6:29.130 scourge_strike Fluffy_Pillow 36.0/100: 36% runic_power blood_charge, dark_transformation, crazed_monstrosity, draenic_strength_potion
6:30.135 scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power blood_charge, dark_transformation, crazed_monstrosity, draenic_strength_potion
6:31.140 unholy_blight Fluffy_Pillow 56.0/100: 56% runic_power blood_charge, dark_transformation, crazed_monstrosity, draenic_strength_potion
6:32.146 outbreak Fluffy_Pillow 56.0/100: 56% runic_power blood_charge, dark_transformation, sudden_doom, crazed_monstrosity, draenic_strength_potion
6:33.150 death_coil Fluffy_Pillow 56.0/100: 56% runic_power blood_charge, dark_transformation, sudden_doom, crazed_monstrosity, draenic_strength_potion
6:34.153 soul_reaper Fluffy_Pillow 56.0/100: 56% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, draenic_strength_potion
6:35.158 scourge_strike Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, draenic_strength_potion
6:36.163 festering_strike Fluffy_Pillow 76.0/100: 76% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, draenic_strength_potion
6:37.166 death_coil Fluffy_Pillow 96.0/100: 96% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, draenic_strength_potion
6:38.170 death_coil Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(5), dark_transformation, unholy_strength, crazed_monstrosity, draenic_strength_potion
6:39.176 death_coil Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(7), sudden_doom, unholy_strength, draenic_strength_potion
6:40.179 blood_tap Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(9), shadow_infusion(2), unholy_strength, draenic_strength_potion
6:40.179 soul_reaper Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(4), shadow_infusion(2), unholy_strength, draenic_strength_potion
6:41.184 death_coil Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(4), shadow_infusion(2), unholy_strength, draenic_strength_potion
6:42.189 festering_strike Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(6), shadow_infusion(4), unholy_strength, draenic_strength_potion
6:43.195 scourge_strike Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(6), shadow_infusion(4), unholy_strength, draenic_strength_potion
6:44.201 death_coil Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(6), shadow_infusion(4), unholy_strength, draenic_strength_potion
6:45.206 dark_transformation Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(8), shadow_infusion(5), unholy_strength, draenic_strength_potion
6:46.211 blood_tap Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity, draenic_strength_potion
6:46.211 soul_reaper Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, draenic_strength_potion
6:47.213 scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, draenic_strength_potion
6:48.217 scourge_strike Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity, draenic_strength_potion
6:49.219 death_coil Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(3), dark_transformation, crazed_monstrosity
6:50.226 Waiting 2.000 sec 16.0/100: 16% runic_power blood_charge(5), dark_transformation, crazed_monstrosity
6:52.226 blood_tap Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(5), dark_transformation, sudden_doom, crazed_monstrosity
6:52.226 soul_reaper Fluffy_Pillow 16.0/100: 16% runic_power dark_transformation, sudden_doom, crazed_monstrosity
6:53.231 death_coil Fluffy_Pillow 26.0/100: 26% runic_power dark_transformation, sudden_doom, crazed_monstrosity
6:54.236 festering_strike Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(2), dark_transformation, crazed_monstrosity
6:55.240 scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power blood_charge(2), dark_transformation, crazed_monstrosity
6:56.245 scourge_strike Fluffy_Pillow 56.0/100: 56% runic_power blood_charge(2), dark_transformation, crazed_monstrosity
6:57.250 death_coil Fluffy_Pillow 66.0/100: 66% runic_power blood_charge(2), dark_transformation, crazed_monstrosity
6:58.254 death_coil Fluffy_Pillow 36.0/100: 36% runic_power blood_charge(4), dark_transformation, crazed_monstrosity
6:59.261 blood_tap Fluffy_Pillow 6.0/100: 6% runic_power blood_charge(6), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
6:59.261 soul_reaper Fluffy_Pillow 6.0/100: 6% runic_power blood_charge, dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
7:00.266 death_coil Fluffy_Pillow 16.0/100: 16% runic_power blood_charge, dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
7:01.270 scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity
7:02.275 festering_strike Fluffy_Pillow 26.0/100: 26% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity
7:03.281 antimagic_shell Shaque 46.0/100: 46% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity
7:03.281 death_coil Fluffy_Pillow 87.0/100: 87% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity
7:04.284 death_coil Fluffy_Pillow 57.0/100: 57% runic_power blood_charge(5), dark_transformation, unholy_strength, crazed_monstrosity
7:05.289 blood_tap Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(7), dark_transformation, unholy_strength, crazed_monstrosity
7:05.289 soul_reaper Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity
7:06.293 death_coil Fluffy_Pillow 37.0/100: 37% runic_power blood_charge(2), dark_transformation, unholy_strength, crazed_monstrosity
7:07.297 festering_strike Fluffy_Pillow 7.0/100: 7% runic_power blood_charge(4), dark_transformation, unholy_strength, crazed_monstrosity
7:08.302 scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(4), dark_transformation, unholy_strength, crazed_monstrosity
7:09.307 death_coil Fluffy_Pillow 37.0/100: 37% runic_power blood_charge(4), dark_transformation, unholy_strength, crazed_monstrosity
7:10.311 death_coil Fluffy_Pillow 7.0/100: 7% runic_power blood_charge(6), dark_transformation, sudden_doom, unholy_strength, crazed_monstrosity
7:11.317 blood_tap Fluffy_Pillow 7.0/100: 7% runic_power blood_charge(8), dark_transformation, unholy_strength, crazed_monstrosity
7:11.317 soul_reaper Fluffy_Pillow 7.0/100: 7% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity
7:12.322 Waiting 0.300 sec 17.0/100: 17% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity
7:12.622 scourge_strike Fluffy_Pillow 17.0/100: 17% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity
7:13.629 Waiting 0.300 sec 27.0/100: 27% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity
7:13.929 festering_strike Fluffy_Pillow 27.0/100: 27% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity
7:14.933 death_coil Fluffy_Pillow 47.0/100: 47% runic_power blood_charge(3), dark_transformation, unholy_strength, crazed_monstrosity
7:15.938 Waiting 1.400 sec 17.0/100: 17% runic_power blood_charge(5), unholy_strength
7:17.338 blood_tap Fluffy_Pillow 17.0/100: 17% runic_power blood_charge(5), unholy_strength
7:17.338 soul_reaper Fluffy_Pillow 17.0/100: 17% runic_power unholy_strength
7:18.343 Waiting 1.100 sec 27.0/100: 27% runic_power unholy_strength
7:19.443 scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power unholy_strength
7:20.448 death_coil Fluffy_Pillow 37.0/100: 37% runic_power unholy_strength
7:21.453 festering_strike Fluffy_Pillow 7.0/100: 7% runic_power blood_charge(2), shadow_infusion(2), unholy_strength
7:22.457 Waiting 1.900 sec 27.0/100: 27% runic_power blood_charge(2), shadow_infusion(2), unholy_strength

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7397 6770 6214 (1312)
Agility 1120 1067 1067
Stamina 8113 7376 7376
Intellect 596 568 568
Spirit 639 639 639
Health 486780 442560 0
Runic Power 100 100 0
Crit 27.95% 22.95% 1974
Haste 46.73% 16.46% 1481
Multistrike 60.95% 53.97% 3562
Damage / Heal Versatility 3.88% 0.88% 114
Attack Power 8137 6770 0
Mastery 54.13% 41.63% 952
Armor 2500 2500 2500

Gear

Source Slot Average Item Level: 733.00
Local Head Helm of Precognition
ilevel: 735, stats: { 349 Armor, +444 StrInt, +667 Sta, +397 Haste, +194 Mult }
Local Neck Corrupted Talonguard Pendant
ilevel: 735, stats: { +250 Str, +375 Sta, +223 Mult, +109 Mastery }, enchant: { +75 Mult }
Local Shoulders Demongaze Pauldrons
ilevel: 710, stats: { 298 Armor, +264 Str, +396 Sta, +206 Mult, +146 Mastery }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Demongaze Chestplate
ilevel: 710, stats: { 397 Armor, +352 Str, +528 Sta, +274 Mult, +194 Crit }
Local Waist Ravenous Girdle
ilevel: 735, stats: { 241 Armor, +333 StrInt, +500 Sta, +288 Mult, +155 Crit }
Local Legs Demongaze Legplates
ilevel: 741, stats: { 383 Armor, +470 Str, +704 Sta, +393 Haste, +232 Mult }
Local Feet Treads of the Defiler
ilevel: 730, stats: { 291 Armor, +318 StrInt, +477 Sta, +303 Haste, +121 Mult }
Local Wrists Hot-Rolled Iron Bracers
ilevel: 720, stats: { 179 Armor, +217 StrInt, +326 Sta, +176 Mult, +114 Vers }
Local Hands Demongaze Gauntlets
ilevel: 735, stats: { 268 Armor, +333 Str, +500 Sta, +279 Crit, +165 Haste }
Local Finger1 Thorasus, the Stone Heart of Draenor
ilevel: 771, stats: { +349 Str, +524 Sta, +246 Crit, +210 Mult }, enchant: { +50 Mult }
Local Finger2 Congealed Globule Loop
ilevel: 735, stats: { +250 Str, +375 Sta, +238 Mult, +95 Mastery }, enchant: { +50 Mult }
Local Trinket1 Unending Hunger
ilevel: 735, stats: { +1100 Crit }
Local Trinket2 Rumbling Pebble
ilevel: 720, stats: { +359 Str, +359 Mastery, +359 Mult }
Local Back Soulbinder's Greatcloak
ilevel: 735, stats: { 94 Armor, +250 Str, +375 Sta, +223 Haste, +109 Mult }, gems: { +75 Mult }, enchant: { +100 Mult }
Local Main Hand Hellrender
ilevel: 746, weapon: { 2546 - 3821, 3.6 }, stats: { +492 Str, +738 Sta, +412 Mult, +243 Mastery }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Plaguebearer Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Blood Tap Runic Empowerment Runic Corruption
75 Death Pact Death Siphon Conversion
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground
100 Necrotic Plague Defile Breath of Sindragosa

Profile

deathknight="Shaque"
origin="https://eu.api.battle.net/wow/character/arathor/Shaque/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hellfire/144/121274000-avatar.jpg"
level=100
race=dwarf
role=attack
position=back
professions=blacksmithing=700/herbalism=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#db!2200000
talent_override=unholy_blight,if=raid_event.adds.count>=1|enemies>1
talent_override=necrotic_plague,if=raid_event.adds.count>=1|enemies>1
glyphs=raise_ally/regenerative_magic/blood_boil/tranquil_grip/skeleton/path_of_frost
spec=unholy

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=salty_squid_roll
actions.precombat+=/horn_of_winter
actions.precombat+=/unholy_presence
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/army_of_the_dead
actions.precombat+=/potion,name=draenic_strength
actions.precombat+=/raise_dead

# Executed every time the actor is available.

actions=auto_attack
actions+=/deaths_advance,if=movement.remains>2
actions+=/antimagic_shell,damage=100000,if=((dot.breath_of_sindragosa.ticking&runic_power<25)|cooldown.breath_of_sindragosa.remains>40)|!talent.breath_of_sindragosa.enabled
actions+=/blood_fury,if=!talent.breath_of_sindragosa.enabled
actions+=/berserking,if=!talent.breath_of_sindragosa.enabled
actions+=/arcane_torrent,if=!talent.breath_of_sindragosa.enabled
actions+=/use_item,slot=finger1,if=!talent.breath_of_sindragosa.enabled
actions+=/potion,name=draenic_strength,if=(buff.dark_transformation.up&target.time_to_die<=60)&!talent.breath_of_sindragosa.enabled
actions+=/run_action_list,name=unholy

actions.unholy=plague_leech,if=((cooldown.outbreak.remains<1)|disease.min_remains<1)&((blood<1&frost<1)|(blood<1&unholy<1)|(frost<1&unholy<1))
actions.unholy+=/soul_reaper,if=(target.health.pct-3*(target.health.pct%target.time_to_die))<=45
actions.unholy+=/blood_tap,if=((target.health.pct-3*(target.health.pct%target.time_to_die))<=45)&cooldown.soul_reaper.remains=0
actions.unholy+=/summon_gargoyle
actions.unholy+=/breath_of_sindragosa,if=runic_power>75
actions.unholy+=/run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
actions.unholy+=/unholy_blight,if=!disease.min_ticking
actions.unholy+=/outbreak,cycle_targets=1,if=!talent.necrotic_plague.enabled&(!(dot.blood_plague.ticking|dot.frost_fever.ticking))
actions.unholy+=/plague_strike,if=(!talent.necrotic_plague.enabled&!(dot.blood_plague.ticking|dot.frost_fever.ticking))|(talent.necrotic_plague.enabled&!dot.necrotic_plague.ticking)
actions.unholy+=/blood_boil,cycle_targets=1,if=(spell_targets.blood_boil>1&!talent.necrotic_plague.enabled)&(!(dot.blood_plague.ticking|dot.frost_fever.ticking))
actions.unholy+=/death_and_decay,if=spell_targets.death_and_decay>1&unholy>1
actions.unholy+=/defile,if=unholy=2
actions.unholy+=/blood_tap,if=talent.defile.enabled&cooldown.defile.remains=0
actions.unholy+=/scourge_strike,if=unholy=2
actions.unholy+=/festering_strike,if=talent.necrotic_plague.enabled&talent.unholy_blight.enabled&dot.necrotic_plague.remains<cooldown.unholy_blight.remains%2
actions.unholy+=/dark_transformation
actions.unholy+=/festering_strike,if=blood=2&frost=2&(((Frost-death)>0)|((Blood-death)>0))
actions.unholy+=/festering_strike,if=(blood=2|frost=2)&(((Frost-death)>0)&((Blood-death)>0))
actions.unholy+=/blood_boil,cycle_targets=1,if=(talent.necrotic_plague.enabled&!dot.necrotic_plague.ticking)&spell_targets.blood_boil>1
actions.unholy+=/defile,if=blood=2|frost=2
actions.unholy+=/death_and_decay,if=spell_targets.death_and_decay>1
actions.unholy+=/defile
actions.unholy+=/blood_boil,if=talent.breath_of_sindragosa.enabled&((spell_targets.blood_boil>=4&(blood=2|(frost=2&death=2)))&(cooldown.breath_of_sindragosa.remains>6|runic_power<75))
actions.unholy+=/blood_boil,if=!talent.breath_of_sindragosa.enabled&(spell_targets.blood_boil>=4&(blood=2|(frost=2&death=2)))
actions.unholy+=/blood_tap,if=buff.blood_charge.stack>10
actions.unholy+=/outbreak,if=talent.necrotic_plague.enabled&debuff.necrotic_plague.stack<=14
actions.unholy+=/death_coil,if=(buff.sudden_doom.react|runic_power>80)&(buff.blood_charge.stack<=10)
actions.unholy+=/blood_boil,if=(spell_targets.blood_boil>=4&(cooldown.breath_of_sindragosa.remains>6|runic_power<75))|(!talent.breath_of_sindragosa.enabled&spell_targets.blood_boil>=4)
actions.unholy+=/scourge_strike,if=(cooldown.breath_of_sindragosa.remains>6|runic_power<75|unholy=2)|!talent.breath_of_sindragosa.enabled
actions.unholy+=/festering_strike,if=(cooldown.breath_of_sindragosa.remains>6|runic_power<75)|!talent.breath_of_sindragosa.enabled
actions.unholy+=/death_coil,if=(cooldown.breath_of_sindragosa.remains>20)|!talent.breath_of_sindragosa.enabled
actions.unholy+=/plague_leech
actions.unholy+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.bos=blood_fury,if=dot.breath_of_sindragosa.ticking
actions.bos+=/berserking,if=dot.breath_of_sindragosa.ticking
actions.bos+=/use_item,slot=finger1,if=dot.breath_of_sindragosa.ticking
actions.bos+=/potion,name=draenic_strength,if=dot.breath_of_sindragosa.ticking
actions.bos+=/unholy_blight,if=!disease.ticking
actions.bos+=/plague_strike,if=!disease.ticking
actions.bos+=/blood_boil,cycle_targets=1,if=(spell_targets.blood_boil>=2&!(dot.blood_plague.ticking|dot.frost_fever.ticking))|spell_targets.blood_boil>=4&(runic_power<88&runic_power>30)
actions.bos+=/death_and_decay,if=spell_targets.death_and_decay>=2&(runic_power<88&runic_power>30)
actions.bos+=/festering_strike,if=(blood=2&frost=2&(((Frost-death)>0)|((Blood-death)>0)))&runic_power<80
actions.bos+=/festering_strike,if=((blood=2|frost=2)&(((Frost-death)>0)&((Blood-death)>0)))&runic_power<80
actions.bos+=/arcane_torrent,if=runic_power<70
actions.bos+=/scourge_strike,if=spell_targets.blood_boil<=3&(runic_power<88&runic_power>30)
actions.bos+=/blood_boil,if=spell_targets.blood_boil>=4&(runic_power<88&runic_power>30)
actions.bos+=/festering_strike,if=runic_power<77
actions.bos+=/scourge_strike,if=(spell_targets.blood_boil>=4&(runic_power<88&runic_power>30))|spell_targets.blood_boil<=3
actions.bos+=/dark_transformation
actions.bos+=/blood_tap,if=buff.blood_charge.stack>=5
actions.bos+=/plague_leech
actions.bos+=/empower_rune_weapon,if=runic_power<60
actions.bos+=/death_coil,if=buff.sudden_doom.react

head=helm_of_precognition,id=124330,bonus_id=567,upgrade=2
neck=corrupted_talonguard_pendant,id=124218,bonus_id=567,upgrade=2,enchant=75mult
shoulders=demongaze_pauldrons,id=124344,bonus_id=566
back=soulbinders_greatcloak,id=124143,bonus_id=565/567,upgrade=2,gems=75mult,enchant=gift_of_multistrike
chest=demongaze_chestplate,id=124317,bonus_id=566
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=hotrolled_iron_bracers,id=124351,bonus_id=567
hands=demongaze_gauntlets,id=124327,bonus_id=567,upgrade=2
waist=ravenous_girdle,id=124348,bonus_id=567,upgrade=2
legs=demongaze_legplates,id=124338,bonus_id=562/567,upgrade=2
feet=treads_of_the_defiler,id=124322,bonus_id=566,upgrade=2
finger1=thorasus_the_stone_heart_of_draenor,id=124634,bonus_id=633/649,enchant=50mult
finger2=congealed_globule_loop,id=124197,bonus_id=567,upgrade=2,enchant=50mult
trinket1=unending_hunger,id=124236,bonus_id=567,upgrade=2
trinket2=rumbling_pebble,id=124235,bonus_id=567
main_hand=hellrender,id=124360,bonus_id=562/567,upgrade=2,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=732.87
# gear_strength=4681
# gear_stamina=6485
# gear_crit_rating=1974
# gear_haste_rating=1481
# gear_mastery_rating=952
# gear_multistrike_rating=3392
# gear_versatility_rating=114
# gear_armor=2500
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1

Arbek

Arbek : 98853 dps, 98853 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
98852.8 98852.8 50.9 / 0.051% 16144.1 / 16.3% 144.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
636.5 636.5 Mana 0.00% 38.7 100.0% 100%
Origin https://eu.api.battle.net/wow/character/arathor/Arbek/advanced
Talents
  • 15: Displacer Beast
  • 30: Renewal
  • 45: Faerie Swarm (Balance Druid)
  • 60: Incarnation: Chosen of Elune
  • 75: Mighty Bash
  • 90: Nature's Vigil
  • 100: Euphoria
  • Talent Calculator
Glyphs
  • Glyph of Stampeding Roar
  • Glyph of Rebirth
  • Glyph of Astral Communion
  • Glyph of Untamed Stars
  • Glyph of Stars
  • Glyph of Grace
Professions
  • inscription: 700
  • tailoring: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Arbek 98853
Moonfire 8809 8.9% 12.8 36.17sec 308775 257105 Direct 12.9 22936 46014 25891 12.8% 4.1 6885 13767 12.6%  
Periodic 278.4 10442 20876 11768 12.7% 89.2 3132 6265 12.7% 98.4%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.82 12.90 278.42 278.42 1.2010 1.5903 3957096.29 3957096.29 0.00 8636.95 257104.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.52 12.61% 13766.93 4979 29061 5602.41 0 29061 7152 7152 0.00
multistrike 3.60 87.39% 6885.49 2406 14531 6726.87 0 12633 24785 24785 0.00
hit 11.24 87.20% 22936.39 8018 48436 22944.38 13436 29495 257920 257920 0.00
crit 1.65 12.80% 46014.29 16057 96872 38001.30 0 96872 75959 75959 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.3 12.70% 6265.44 11 20978 6272.06 0 18636 70959 70959 0.00
multistrike 77.9 87.30% 3132.26 1 10489 3135.84 2285 4301 243934 243934 0.00
hit 243.0 87.29% 10441.60 2 34963 10454.02 9489 11655 2537732 2537732 0.00
crit 35.4 12.71% 20875.85 7 69927 20905.46 12022 30694 738655 738655 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:480.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that burns the enemy for {$164812s1=1 + 41.2%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.412340
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.297648
  • base_td:0.00
  • dot_duration:40.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Nithramus 8974 9.1% 4.1 120.85sec 974276 0 Direct 4.1 974280 0 974280 0.0% 0.0 0 0 0.0%  

Stats details: nithramus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.12 4.12 0.00 0.00 0.0000 0.0000 4017489.09 4017489.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.12 100.00% 974279.50 343980 2631480 980049.25 715344 1375067 4017489 4017489 0.00
 
 

Action details: nithramus

Static Values
  • id:187625
  • school:arcane
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187625
  • name:Nithramus
  • school:arcane
  • tooltip:
  • description:{$@spelldesc187611=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1513138.00
  • base_dd_max:1513138.00
 
Starfall 0 (8199) 0.0% (8.3%) 45.6 10.00sec 80736 0

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.60 45.60 359.03 359.03 0.0000 0.9892 0.00 0.00 0.00 10366.78 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 313.3 87.28% 0.00 0 0 0.00 0 0 0 0 0.00
crit 45.7 12.72% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:48505
  • name:Starfall
  • school:arcane
  • tooltip:
  • description:A Lunar spell that strikes all enemies{$?s146655=true}[][ afflicted by your Moonfire or Sunfire] within $50286a yards. Deals {$50288s1=0 + 29.7%} Arcane damage every $184989t1 sec for {$184989d=10 seconds}. Max 3 charges. Charges are shared with Starsurge. Shapeshifting into an animal form or losing control of your character will cancel the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Starfall (_pulse) 8199 8.3% 359.0 1.25sec 10254 0 Periodic 357.8 8326 16651 9385 12.7% 114.7 2499 5005 12.7% 0.0%

Stats details: starfall_pulse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 359.03 0.00 0.00 357.84 0.0000 0.0000 3681596.72 3681596.72 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 14.6 12.71% 5005.46 1944 15030 5018.10 0 10768 72957 72957 0.00
multistrike 100.1 87.29% 2499.04 972 7515 2505.17 1944 3346 250268 250268 0.00
hit 312.3 87.28% 8326.29 3241 25049 8346.01 7093 9680 2600532 2600532 0.00
crit 45.5 12.72% 16650.54 6481 50099 16691.32 11912 25001 757840 757840 0.00
 
 

Action details: starfall_pulse

Static Values
  • id:50288
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50288
  • name:Starfall
  • school:arcane
  • tooltip:
  • description:{$@spelldesc48505=A Lunar spell that strikes all enemies{$?s146655=true}[][ afflicted by your Moonfire or Sunfire] within $50286a yards. Deals {$50288s1=0 + 29.7%} Arcane damage every $184989t1 sec for {$184989d=10 seconds}. Max 3 charges. Charges are shared with Starsurge. Shapeshifting into an animal form or losing control of your character will cancel the effect.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.296800
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Starfire 26243 26.6% 95.2 4.72sec 123833 59101 Direct 95.2 100240 200231 112976 12.7% 30.5 30069 60305 12.7%  

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.21 95.21 0.00 0.00 2.0953 0.0000 11789766.35 11789766.35 0.00 59100.72 59100.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.87 12.69% 60304.76 19963 156732 59031.55 0 156732 233322 233322 0.00
multistrike 26.62 87.31% 30069.34 9417 78366 30111.91 20285 43611 800306 800306 0.00
hit 83.08 87.26% 100240.27 31389 261219 100372.54 87292 113992 8328057 8328057 0.00
crit 12.13 12.74% 200230.77 66544 522439 200559.11 0 411027 2428082 2428082 0.00
 
 

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that causes {$s1=1 + 238.1%} Arcane damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.380760
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starsurge 14675 14.8% 47.7 9.56sec 137924 114216 Direct 47.6 111866 223683 126091 12.7% 15.3 33569 67196 12.8%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.74 47.63 0.00 0.00 1.2076 0.0000 6583873.30 6583873.30 0.00 114216.11 114216.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.95 12.77% 67196.14 35901 150726 57481.79 0 150726 131060 131060 0.00
multistrike 13.33 87.23% 33569.26 17364 75363 33677.65 22570 55453 447341 447341 0.00
hit 41.57 87.28% 111866.21 57880 251209 112205.46 95193 142165 4650232 4650232 0.00
crit 6.06 12.72% 223682.57 116128 502418 223748.62 0 502418 1355240 1355240 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:
  • description:Instantly causes {$78674s1=7227} Spellstorm damage to the target, benefiting from your strongest current Eclipse bonus. Also grants Lunar or Solar Empowerment, based on current Balance Energy side, which increases the damage of your next $164547n Starfires or $164545n Wraths by {$164545s1=30}%. Max 3 charges. Charges shared with Starfall.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.976480
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Sunfire 9330 9.4% 19.0 22.38sec 220931 180450 Direct 23.8 22790 45601 25699 12.8% 7.6 6837 13637 12.8%  
Periodic 277.8 10255 20532 11560 12.7% 89.1 3077 6152 12.7% 98.1%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.97 23.82 277.78 277.78 1.2243 1.5893 4191315.56 4191315.56 0.00 9019.03 180450.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.98 12.77% 13637.22 4928 30426 8520.62 0 30426 13298 13298 0.00
multistrike 6.66 87.23% 6837.49 2405 18934 6828.39 0 11462 45549 45549 0.00
hit 20.78 87.25% 22789.82 8016 63114 22795.11 17722 27570 473570 473570 0.00
crit 3.04 12.75% 45601.09 16178 120610 43780.15 0 81727 138512 138512 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.4 12.75% 6151.57 2 27335 6161.73 2221 17217 69879 69879 0.00
multistrike 77.7 87.25% 3076.95 1 13668 3081.62 2109 4141 239208 239208 0.00
hit 242.5 87.30% 10254.81 3 45559 10270.57 9303 11632 2486743 2486743 0.00
crit 35.3 12.70% 20532.07 6 91118 20563.44 12368 32403 724557 724557 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1056.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.balance_of_power.enabled&((remains<solar_max&eclipse_dir.solar)|(buff.solar_peak.up&buff.solar_peak.remains<action.wrath.cast_time))
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every {$t2=0} seconds.
  • description:A Solar spell that burns the enemy for {$164815s1=1002} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[ to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.412340
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.297648
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Wrath 16240 16.4% 105.2 4.06sec 69325 48233 Direct 104.8 56341 112626 63511 12.7% 33.6 16900 33824 12.7%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.25 104.81 0.00 0.00 1.4373 0.0000 7296342.68 7296342.68 0.00 48233.27 48233.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.26 12.67% 33824.31 14218 88840 33318.90 0 88840 144059 144059 0.00
multistrike 29.35 87.33% 16899.66 6707 44420 16924.05 13318 23348 495923 495923 0.00
hit 91.45 87.26% 56340.93 22356 148066 56422.96 49707 67996 5152632 5152632 0.00
crit 13.35 12.74% 112626.16 47394 296133 112794.73 81304 178149 1503729 1503729 0.00
 
 

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy<0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:
  • description:A Solar spell that causes {$s1=3613} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.488240
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - fey_moonwing 8845 / 6383
Fey Missile 8845 6.5% 454.4 0.95sec 6326 3907 Direct 452.4 5142 10284 5796 12.7% 145.0 1542 3085 12.7%  

Stats details: fey_missile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 454.37 452.41 0.00 0.00 1.6192 0.0000 2874152.47 2874152.47 0.00 3906.70 3906.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 18.46 12.73% 3085.20 2695 5314 3085.21 2695 4089 56956 56956 0.00
multistrike 126.59 87.27% 1542.41 1347 2657 1542.52 1399 1761 195252 195252 0.00
hit 394.90 87.29% 5142.05 4491 8857 5142.35 4719 5729 2030618 2030618 0.00
crit 57.50 12.71% 10283.50 8982 17715 10283.87 9178 12052 591327 591327 0.00
 
 

Action details: fey_missile

Static Values
  • id:188046
  • school:spellstorm
  • resource:none
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.600
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188046
  • name:Fey Missile
  • school:spellstorm
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.603155
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Arbek
Celestial Alignment 3.0 188.82sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 2.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.60 87.31% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.38 12.69% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:112071
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:112071
  • name:Celestial Alignment
  • school:physical
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
 
Draenic Intellect Potion (potion) 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: potion

Static Values
  • id:156426
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your Intellect by {$s1=1000} for {$d=25 seconds}.
 
Incarnation: Chosen of Elune (incarnation) 3.0 188.77sec

Stats details: incarnation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.8228 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.61 87.32% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.38 12.68% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: incarnation

Static Values
  • id:102560
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Incarnation: Chosen of Elune activated.
  • description:An improved Moonkin Form that increases all your spell damage by an additional {$s1=15}%. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.87 87.38% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.13 12.62% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2976.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.03% 9.46% 0.0(0.0)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 3.0 0.0 185.6sec 188.8sec 9.86% 9.66% 0.0(0.0)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • celestial_alignment_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
Draenic Intellect Potion 2.0 0.0 182.4sec 0.0sec 10.84% 10.85% 0.0(0.0)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:10.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your Intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Faerie Blessing 3.5 29.7 119.8sec 13.1sec 93.68% 93.69% 29.7(29.7)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_faerie_blessing
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faerie_blessing_1:93.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188086
  • name:Faerie Blessing
  • tooltip:Arcane and Nature damage increased by $w1%.
  • description:{$@spelldesc187877=When a Faerie Dragon is summoned, your Arcane and Nature damage is increased by $188086m1% for {$188086d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune (incarnation) 3.0 0.0 184.9sec 188.8sec 18.32% 18.34% 0.0(0.0)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_incarnation
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • incarnation_1:18.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Incarnation: Chosen of Elune activated.
  • description:An improved Moonkin Form that increases all your spell damage by an additional {$s1=15}%. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Lunar Empowerment 26.6 0.4 17.0sec 17.2sec 51.19% 51.50% 0.4(0.5)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_lunar_empowerment
  • max_stacks:2
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lunar_empowerment_1:20.71%
  • lunar_empowerment_2:30.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Starfire is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Starfires within {$d=40 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Lunar Peak 20.6 0.0 21.4sec 21.4sec 21.05% 24.24% 0.0(0.0)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_lunar_peak
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lunar_peak_1:21.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171743
  • name:Lunar Peak
  • tooltip:Increases the direct damage of your next Moonfire by {$s1=100}%.
  • description:{$@spelldesc8921=A Lunar spell that burns the enemy for {$164812s1=1 + 41.2%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of Bleeding Hollow 13.0 7.3 35.8sec 22.4sec 43.45% 43.46% 7.3(7.3)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_mark_of_bleeding_hollow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:500.00

Stack Uptimes

  • mark_of_bleeding_hollow_1:43.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173322
  • name:Mark of Bleeding Hollow
  • tooltip:Mastery increased by $w1.
  • description:Mastery increased by {$s1=500}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Nithramus 4.3 0.0 120.9sec 120.7sec 14.19% 13.38% 0.0(0.0)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_nithramus
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nithramus_1:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187616
  • name:Nithramus
  • tooltip:$?$w1>0[Damage dealt increased by $w1%. When this effect ends, the triggering ally will explode for $w1% of all damage dealt while empowered.][Contributing toward the master's Savage Hollows.]
  • description:{$@spelldesc187611=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Sign of the Dark Star 7.9 0.0 58.8sec 58.4sec 34.42% 34.43% 0.0(0.0)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_sign_of_the_dark_star
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1910.00

Stack Uptimes

  • sign_of_the_dark_star_1:34.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:183924
  • name:Sign of the Dark Star
  • tooltip:Increases Intellect by {$s1=584}.
  • description:{$@spelldesc183775=Your spells and abilities have a chance to grant {$183924s1=584} Intellect for {$183924d=20 seconds}. (Approximately ${$procrppm}.2 procs per minute)}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 20.2 0.6 21.0sec 20.4sec 53.80% 55.31% 0.6(1.0)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • solar_empowerment_1:13.78%
  • solar_empowerment_2:12.38%
  • solar_empowerment_3:27.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Wraths within {$d=40 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Peak 20.1 0.0 21.4sec 21.4sec 19.46% 24.37% 0.0(0.0)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_solar_peak
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • solar_peak_1:19.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171744
  • name:Solar Peak
  • tooltip:Increases the direct damage of your next Sunfire by {$s1=100}%.
  • description:{$@spelldesc93402=A Solar spell that burns the enemy for {$164815s1=1002} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[ to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Starfall 12.8 32.8 35.8sec 10.0sec 79.03% 79.04% 371.3(371.3)

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • starfall_1:79.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184989
  • name:Starfall
  • tooltip:Summoning stars from the sky.
  • description:{$@spelldesc48505=A Lunar spell that strikes all enemies{$?s146655=true}[][ afflicted by your Moonfire or Sunfire] within $50286a yards. Deals {$50288s1=0 + 29.7%} Arcane damage every $184989t1 sec for {$184989d=10 seconds}. Max 3 charges. Charges are shared with Starsurge. Shapeshifting into an animal form or losing control of your character will cancel the effect.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Greater Draenic Intellect Flask

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
Moonkin Form

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
sleeper_sushi_food

Buff details

  • buff initial source:Arbek
  • cooldown name:buff_sleeper_sushi_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:125.00

Stack Uptimes

  • sleeper_sushi_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Arbek
moonfire Mana 12.9 6190.0 480.0 483.0 639.3
starfire Mana 95.2 91399.1 960.0 960.0 129.0
starsurge Mana 47.7 45826.1 960.0 960.0 143.7
sunfire Mana 23.8 25151.0 1056.0 1325.8 166.6
wrath Mana 105.2 117878.4 1120.0 1120.0 61.9
Resource Gains Type Count Total Average Overflow
energy_regen Energy 841.82 0.00 (0.00%) 0.00 5618.95 100.00%
mp5_regen Mana 841.82 285797.57 (100.00%) 339.50 793052.38 73.51%
Resource RPS-Gain RPS-Loss
Mana 635.09 636.53
Combat End Resource Mean Min Max
Mana 159350.10 157348.76 160000.00
Eclipse -15.70 -105.00 105.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 46.5%

Procs

Count Interval
Shooting Stars overflow (buff already up) 0.2 83.9sec
Shooting Stars 31.4 14.0sec
Starshards 45.6 9.9sec
wrong_eclipse_wrath 0.0 296.4sec
wrong_eclipse_starfire 4.6 76.1sec

Statistics & Data Analysis

Fight Length
Sample Data Arbek Fight Length
Count 24999
Mean 450.01
Minimum 351.82
Maximum 558.10
Spread ( max - min ) 206.27
Range [ ( max - min ) / 2 * 100% ] 22.92%
DPS
Sample Data Arbek Damage Per Second
Count 24999
Mean 98852.84
Minimum 83974.97
Maximum 117276.22
Spread ( max - min ) 33301.24
Range [ ( max - min ) / 2 * 100% ] 16.84%
Standard Deviation 4106.2595
5th Percentile 92411.43
95th Percentile 105921.65
( 95th Percentile - 5th Percentile ) 13510.21
Mean Distribution
Standard Deviation 25.9708
95.00% Confidence Intervall ( 98801.94 - 98903.75 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6628
0.1 Scale Factor Error with Delta=300 143938
0.05 Scale Factor Error with Delta=300 575753
0.01 Scale Factor Error with Delta=300 14393832
Priority Target DPS
Sample Data Arbek Priority Target Damage Per Second
Count 24999
Mean 98852.84
Minimum 83974.97
Maximum 117276.22
Spread ( max - min ) 33301.24
Range [ ( max - min ) / 2 * 100% ] 16.84%
Standard Deviation 4106.2595
5th Percentile 92411.43
95th Percentile 105921.65
( 95th Percentile - 5th Percentile ) 13510.21
Mean Distribution
Standard Deviation 25.9708
95.00% Confidence Intervall ( 98801.94 - 98903.75 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6628
0.1 Scale Factor Error with Delta=300 143938
0.05 Scale Factor Error with Delta=300 575753
0.01 Scale Factor Error with Delta=300 14393832
DPS(e)
Sample Data Arbek Damage Per Second (Effective)
Count 24999
Mean 98852.84
Minimum 83974.97
Maximum 117276.22
Spread ( max - min ) 33301.24
Range [ ( max - min ) / 2 * 100% ] 16.84%
Damage
Sample Data Arbek Damage
Count 24999
Mean 41517479.98
Minimum 28932779.52
Maximum 54367161.46
Spread ( max - min ) 25434381.94
Range [ ( max - min ) / 2 * 100% ] 30.63%
DTPS
Sample Data Arbek Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Arbek Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Arbek Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Arbek Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Arbek Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Arbek Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ArbekTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Arbek Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_sushi
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 moonkin_form
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 incarnation
7 0.00 starfire
Default action list Executed every time the actor is available.
# count action,conditions
0.00 force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
8 0.00 call_action_list,name=cooldowns,if=cooldown.celestial_alignment.up&(eclipse_energy>=0|target.time_to_die<=30+gcd)
9 4.34 use_item,slot=finger2
A 0.00 call_action_list,name=ca_aoe,if=buff.celestial_alignment.up&spell_targets.starfall_pulse>1&!t18_class_trinket
B 0.00 call_action_list,name=ca,if=buff.celestial_alignment.up&(spell_targets.starfall_pulse=1|t18_class_trinket)
C 0.00 call_action_list,name=aoe_t18_trinket,if=buff.celestial_alignment.down&spell_targets.starfall.pulse>1&t18_class_trinket
D 0.00 call_action_list,name=aoe,if=spell_targets.starfall_pulse>1&buff.celestial_alignment.down&!t18_class_trinket
E 0.00 call_action_list,name=single_target,if=spell_targets.starfall_pulse=1&buff.celestial_alignment.down
actions.single_target
# count action,conditions
F 2.10 starsurge,if=charges=3
G 18.83 starsurge,if=buff.lunar_empowerment.down&eclipse_energy>40
H 19.50 starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
I 18.89 sunfire,if=!talent.balance_of_power.enabled&((remains<solar_max&eclipse_dir.solar)|(buff.solar_peak.up&buff.solar_peak.remains<action.wrath.cast_time))
0.00 sunfire,if=talent.balance_of_power.enabled&(remains<lunar_max+10|remains<action.wrath.cast_time)
0.00 stellar_flare,if=remains<7
0.00 moonfire,if=!talent.euphoria.enabled&!talent.balance_of_power.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+20))
J 7.97 moonfire,if=talent.euphoria.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+10))
0.00 moonfire,if=talent.balance_of_power.enabled&(remains<solar_max+10|remains<action.starfire.cast_time)
K 103.82 wrath,if=(eclipse_energy<0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
L 79.24 starfire
actions.ca
# count action,conditions
M 7.30 starsurge,if=(buff.lunar_empowerment.down&eclipse_energy>=0)|(buff.solar_empowerment.down&eclipse_energy<0)
N 2.26 moonfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
O 0.05 sunfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
P 15.31 starfire,if=eclipse_energy>=0&buff.celestial_alignment.remains>cast_time
Q 1.84 wrath,if=buff.celestial_alignment.remains>cast_time
R 2.59 moonfire,cycle_targets=1
S 0.03 sunfire,cycle_targets=1
actions.cooldowns
# count action,conditions
T 1.99 incarnation
U 1.00 potion,name=draenic_intellect
V 2.98 celestial_alignment

Sample Sequence

013567V9MNPPMPPMPPQRLLLLLKKKKHKKILLGLLLKKKKKHILLLGJKKKKKKHLLGLLKIKKHKKILGLLJLKKKKKILGL9LGKKKKKKILLLLJKKKKHLLLLLIKKKKKILLLTUVMPNPPPPRKKKKHKLLGLLLKKKKKILLLLJK9HKKKKILGLLGKKHKKKHILLGLLJKKKHKKILLGLLKKHKKKHILGLLGJKKKHKKILLGLLLKKKKKILLLJGKH9KKKKILTVPPPPPMQRLLGKKHKKKKILLLLKKKKHKILGLLGJKKKKKKI

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre moonkin_form Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
Pre incarnation Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse incarnation, draenic_intellect_potion
0:00.000 starfire Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse incarnation, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:00.000 celestial_alignment Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse incarnation, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:00.000 use_item_nithramus_the_allseer Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse incarnation, celestial_alignment, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:00.000 starsurge Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse incarnation, celestial_alignment, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:01.236 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, lunar_empowerment(2), starfall, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:02.240 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, lunar_empowerment(2), starfall, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:03.760 starfire Fluffy_Pillow 159050.5/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, lunar_empowerment, starfall, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:05.281 starsurge Fluffy_Pillow 159053.1/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, starfall, faerie_blessing, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:06.286 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:07.807 starfire Fluffy_Pillow 159053.1/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:09.326 starsurge Fluffy_Pillow 159047.8/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, starfall, faerie_blessing, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:10.331 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:11.852 starfire Fluffy_Pillow 159053.1/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:13.372 wrath Fluffy_Pillow 159050.5/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, starfall, faerie_blessing, nithramus, sign_of_the_dark_star, draenic_intellect_potion
0:14.642 moonfire Fluffy_Pillow 158895.7/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, starfall, faerie_blessing, nithramus, sign_of_the_dark_star, draenic_intellect_potion
0:15.647 starfire Fluffy_Pillow 159985.4/160000: 100% mana | 21.2/105: 20% eclipse bloodlust, incarnation, starfall, faerie_blessing, sign_of_the_dark_star, draenic_intellect_potion
0:17.548 starfire Fluffy_Pillow 159053.1/160000: 99% mana | 75.4/105: 72% eclipse bloodlust, incarnation, starfall, faerie_blessing, sign_of_the_dark_star, draenic_intellect_potion
0:19.448 starfire Fluffy_Pillow 159050.5/160000: 99% mana | 103.4/105: 99% eclipse bloodlust, incarnation, lunar_peak, starfall, faerie_blessing, sign_of_the_dark_star, draenic_intellect_potion
0:21.349 starfire Fluffy_Pillow 159053.1/160000: 99% mana | 95.7/105: 91% eclipse bloodlust, incarnation, lunar_peak, starfall, faerie_blessing, draenic_intellect_potion
0:23.250 starfire Fluffy_Pillow 159053.1/160000: 99% mana | 54.9/105: 52% eclipse bloodlust, incarnation, lunar_peak, faerie_blessing
0:25.150 wrath Fluffy_Pillow 159050.5/160000: 99% mana | -4.9/105: -5% eclipse bloodlust, incarnation, faerie_blessing
0:26.419 wrath Fluffy_Pillow 158893.1/160000: 99% mana | -45.3/105: -43% eclipse bloodlust, faerie_blessing
0:27.687 wrath Fluffy_Pillow 158890.5/160000: 99% mana | -78.5/105: -75% eclipse bloodlust, faerie_blessing
0:28.956 wrath Fluffy_Pillow 158893.1/160000: 99% mana | -99.4/105: -95% eclipse bloodlust, faerie_blessing
0:30.226 starsurge Fluffy_Pillow 158895.7/160000: 99% mana | -104.7/105: -100% eclipse bloodlust, solar_peak, faerie_blessing
0:31.229 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -97.3/105: -93% eclipse bloodlust, solar_peak, solar_empowerment(3), starfall, faerie_blessing
0:32.245 wrath Fluffy_Pillow 158893.1/160000: 99% mana | -79.9/105: -76% eclipse bloodlust, solar_peak, solar_empowerment(2), starfall, faerie_blessing
0:33.259 sunfire Fluffy_Pillow 158887.8/160000: 99% mana | -54.6/105: -52% eclipse bloodlust, solar_peak, solar_empowerment, starfall, faerie_blessing
0:34.265 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -24.0/105: -23% eclipse bloodlust, solar_empowerment, starfall, faerie_blessing
0:36.164 starfire Fluffy_Pillow 159047.8/160000: 99% mana | 37.5/105: 36% eclipse bloodlust, solar_empowerment, starfall, faerie_blessing
0:38.063 starsurge Fluffy_Pillow 159047.8/160000: 99% mana | 86.2/105: 82% eclipse bloodlust, solar_empowerment, starfall, faerie_blessing
0:39.066 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 100.5/105: 96% eclipse bloodlust, lunar_empowerment(2), lunar_peak, solar_empowerment, starfall, faerie_blessing
0:40.586 starfire Fluffy_Pillow 159050.5/160000: 99% mana | 103.2/105: 98% eclipse bloodlust, lunar_empowerment, lunar_peak, solar_empowerment, faerie_blessing
0:42.108 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 82.8/105: 79% eclipse lunar_peak, solar_empowerment, faerie_blessing
0:44.575 wrath Fluffy_Pillow 159047.1/160000: 99% mana | 14.0/105: 13% eclipse solar_empowerment, faerie_blessing
0:45.893 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -29.1/105: -28% eclipse faerie_blessing
0:47.539 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -75.2/105: -72% eclipse faerie_blessing, mark_of_bleeding_hollow
0:49.184 wrath Fluffy_Pillow 158884.8/160000: 99% mana | -101.6/105: -97% eclipse solar_peak, faerie_blessing, mark_of_bleeding_hollow
0:50.831 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -101.4/105: -97% eclipse solar_peak, faerie_blessing, mark_of_bleeding_hollow
0:52.479 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -74.7/105: -71% eclipse solar_peak, faerie_blessing, mark_of_bleeding_hollow
0:53.715 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | -41.2/105: -39% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow
0:54.952 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -1.6/105: -2% eclipse solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow
0:57.421 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 72.4/105: 69% eclipse solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow
0:59.890 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 104.9/105: 100% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
1:02.358 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 77.5/105: 74% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow
1:03.596 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 44.8/105: 43% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow
1:04.833 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 5.5/105: 5% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow
1:06.152 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -37.2/105: -35% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
1:07.471 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -73.6/105: -70% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
1:08.788 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -97.5/105: -93% eclipse lunar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
1:10.436 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -104.0/105: -99% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
1:12.084 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -83.3/105: -79% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
1:13.731 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -40.8/105: -39% eclipse lunar_empowerment(2), solar_peak, faerie_blessing
1:14.967 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -1.1/105: -1% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing
1:16.944 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 60.2/105: 57% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
1:18.920 starsurge Fluffy_Pillow 159051.9/160000: 99% mana | 99.0/105: 94% eclipse solar_empowerment(3), starfall, faerie_blessing
1:20.156 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(3), starfall, faerie_blessing
1:22.132 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 82.3/105: 78% eclipse lunar_empowerment, lunar_peak, solar_empowerment(3), starfall, faerie_blessing
1:24.109 wrath Fluffy_Pillow 159054.3/160000: 99% mana | 29.0/105: 28% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
1:25.427 sunfire Fluffy_Pillow 158889.5/160000: 99% mana | -14.0/105: -13% eclipse solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
1:26.664 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -52.4/105: -50% eclipse solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
1:27.982 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -84.6/105: -81% eclipse solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:29.302 starsurge Fluffy_Pillow 158894.3/160000: 99% mana | -102.5/105: -98% eclipse solar_peak, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:30.538 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -103.5/105: -99% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:31.856 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -87.7/105: -83% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:33.174 sunfire Fluffy_Pillow 158889.5/160000: 99% mana | -57.0/105: -54% eclipse solar_peak, solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:34.409 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -19.4/105: -18% eclipse solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:36.878 starsurge Fluffy_Pillow 159051.9/160000: 99% mana | 58.4/105: 56% eclipse solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:38.114 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 87.1/105: 83% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:40.090 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 105.0/105: 100% eclipse lunar_empowerment, lunar_peak, solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star
1:42.066 moonfire Fluffy_Pillow 159051.9/160000: 99% mana | 83.6/105: 80% eclipse lunar_peak, solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:43.302 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 53.4/105: 51% eclipse solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:45.772 wrath Fluffy_Pillow 159054.3/160000: 99% mana | -25.2/105: -24% eclipse solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:47.090 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -64.1/105: -61% eclipse starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
1:48.738 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -96.9/105: -92% eclipse starfall, faerie_blessing, mark_of_bleeding_hollow
1:50.385 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -104.2/105: -99% eclipse solar_peak, faerie_blessing, mark_of_bleeding_hollow
1:52.032 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -84.3/105: -80% eclipse solar_peak, faerie_blessing, mark_of_bleeding_hollow
1:53.681 sunfire Fluffy_Pillow 158894.3/160000: 99% mana | -42.3/105: -40% eclipse solar_peak, faerie_blessing, mark_of_bleeding_hollow
1:54.917 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -2.7/105: -3% eclipse faerie_blessing, mark_of_bleeding_hollow
1:57.386 starsurge Fluffy_Pillow 159051.9/160000: 99% mana | 71.5/105: 68% eclipse faerie_blessing, mark_of_bleeding_hollow
1:58.623 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 95.3/105: 91% eclipse lunar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
2:00.596 use_item_nithramus_the_allseer Fluffy_Pillow 159044.8/160000: 99% mana | 103.2/105: 98% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
2:00.596 starfire Fluffy_Pillow 159044.8/160000: 99% mana | 103.2/105: 98% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing, nithramus
2:02.571 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 72.6/105: 69% eclipse lunar_peak, starfall, faerie_blessing, nithramus, sign_of_the_dark_star
2:03.807 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 38.4/105: 37% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing, nithramus, sign_of_the_dark_star
2:05.455 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -15.0/105: -14% eclipse lunar_empowerment(2), starfall, faerie_blessing, nithramus, sign_of_the_dark_star
2:07.102 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -64.4/105: -61% eclipse lunar_empowerment(2), starfall, faerie_blessing, nithramus, sign_of_the_dark_star
2:08.748 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -97.0/105: -92% eclipse lunar_empowerment(2), starfall, faerie_blessing, nithramus, sign_of_the_dark_star
2:10.395 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -104.2/105: -99% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, nithramus, sign_of_the_dark_star
2:12.043 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -84.1/105: -80% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, nithramus, sign_of_the_dark_star
2:13.690 sunfire Fluffy_Pillow 158889.5/160000: 99% mana | -42.0/105: -40% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow
2:14.924 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -2.5/105: -2% eclipse lunar_empowerment(2), starfall, faerie_blessing, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow
2:16.898 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 59.0/105: 56% eclipse lunar_empowerment, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:18.874 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 98.5/105: 94% eclipse faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:21.343 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 95.8/105: 91% eclipse lunar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:23.814 moonfire Fluffy_Pillow 159056.7/160000: 99% mana | 38.2/105: 36% eclipse lunar_peak, faerie_blessing, mark_of_bleeding_hollow
2:25.051 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -1.7/105: -2% eclipse faerie_blessing, mark_of_bleeding_hollow
2:26.698 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -53.4/105: -51% eclipse faerie_blessing
2:28.347 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -91.2/105: -87% eclipse faerie_blessing
2:29.993 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -105.0/105: -100% eclipse solar_peak, faerie_blessing
2:31.641 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -91.4/105: -87% eclipse solar_peak, faerie_blessing
2:32.878 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -64.9/105: -62% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing
2:35.347 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 11.4/105: 11% eclipse solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star
2:37.816 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 81.2/105: 77% eclipse solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star
2:40.283 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 104.6/105: 100% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star
2:42.750 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 68.2/105: 65% eclipse lunar_peak, solar_empowerment(3), faerie_blessing, sign_of_the_dark_star
2:45.218 sunfire Fluffy_Pillow 159049.5/160000: 99% mana | -7.2/105: -7% eclipse solar_empowerment(3), faerie_blessing, sign_of_the_dark_star
2:46.454 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -46.3/105: -44% eclipse solar_empowerment(3), faerie_blessing, sign_of_the_dark_star
2:47.771 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -80.3/105: -76% eclipse solar_empowerment(2), faerie_blessing, sign_of_the_dark_star
2:49.089 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -100.7/105: -96% eclipse solar_peak, solar_empowerment, faerie_blessing, sign_of_the_dark_star
2:50.408 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -104.1/105: -99% eclipse solar_peak, faerie_blessing, sign_of_the_dark_star
2:52.055 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -83.9/105: -80% eclipse solar_peak, faerie_blessing, sign_of_the_dark_star
2:53.703 sunfire Fluffy_Pillow 158891.9/160000: 99% mana | -41.6/105: -40% eclipse solar_peak, faerie_blessing, sign_of_the_dark_star
2:54.940 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -2.0/105: -2% eclipse faerie_blessing
2:57.411 starfire Fluffy_Pillow 159056.7/160000: 99% mana | 72.1/105: 69% eclipse faerie_blessing, mark_of_bleeding_hollow
2:59.879 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 104.9/105: 100% eclipse lunar_peak, faerie_blessing, mark_of_bleeding_hollow
3:02.348 incarnation Fluffy_Pillow 159051.9/160000: 99% mana | 77.7/105: 74% eclipse lunar_peak, faerie_blessing, mark_of_bleeding_hollow
3:03.584 potion Fluffy_Pillow 160000.0/160000: 100% mana | 45.2/105: 43% eclipse incarnation, lunar_peak, faerie_blessing, mark_of_bleeding_hollow
3:03.584 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 45.2/105: 43% eclipse incarnation, lunar_peak, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:03.584 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 45.2/105: 43% eclipse incarnation, celestial_alignment, lunar_peak, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:04.819 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 45.2/105: 43% eclipse incarnation, celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:06.794 moonfire Fluffy_Pillow 159049.5/160000: 99% mana | 45.2/105: 43% eclipse incarnation, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:08.032 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 45.2/105: 43% eclipse incarnation, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:10.008 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 45.2/105: 43% eclipse incarnation, celestial_alignment, starfall, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:12.478 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 45.2/105: 43% eclipse incarnation, celestial_alignment, starfall, faerie_blessing, draenic_intellect_potion
3:14.946 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 45.2/105: 43% eclipse incarnation, celestial_alignment, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:17.415 moonfire Fluffy_Pillow 159051.9/160000: 99% mana | 45.2/105: 43% eclipse incarnation, celestial_alignment, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:18.653 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 43.1/105: 41% eclipse incarnation, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:20.302 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -9.9/105: -9% eclipse incarnation, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:21.951 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -60.4/105: -58% eclipse incarnation, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:23.598 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -95.0/105: -90% eclipse incarnation, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:25.246 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -104.7/105: -100% eclipse incarnation, solar_peak, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:26.484 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -93.8/105: -89% eclipse incarnation, solar_peak, solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:27.804 starfire Fluffy_Pillow 158894.3/160000: 99% mana | -66.8/105: -64% eclipse incarnation, solar_peak, solar_empowerment(2), starfall, faerie_blessing, draenic_intellect_potion
3:30.272 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 9.0/105: 9% eclipse incarnation, solar_empowerment(2), starfall, faerie_blessing
3:32.740 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 79.6/105: 76% eclipse solar_empowerment(2), starfall
3:33.978 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 99.6/105: 95% eclipse lunar_empowerment(2), solar_empowerment(2), starfall
3:35.954 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 100.3/105: 96% eclipse lunar_empowerment, lunar_peak, solar_empowerment(2), starfall
3:37.929 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 63.6/105: 61% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
3:40.397 wrath Fluffy_Pillow 159049.5/160000: 99% mana | -13.1/105: -12% eclipse solar_empowerment(2), starfall, faerie_blessing
3:41.717 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -53.9/105: -51% eclipse solar_empowerment, starfall, faerie_blessing
3:43.036 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -85.6/105: -82% eclipse starfall, faerie_blessing
3:44.685 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -104.5/105: -100% eclipse solar_peak, starfall, faerie_blessing
3:46.335 wrath Fluffy_Pillow 158896.7/160000: 99% mana | -95.9/105: -91% eclipse solar_peak, faerie_blessing
3:47.983 sunfire Fluffy_Pillow 158891.9/160000: 99% mana | -62.2/105: -59% eclipse solar_peak, faerie_blessing
3:49.219 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -25.5/105: -24% eclipse faerie_blessing
3:51.687 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 53.1/105: 51% eclipse faerie_blessing
3:54.156 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 101.3/105: 97% eclipse lunar_peak, faerie_blessing
3:56.625 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 91.6/105: 87% eclipse lunar_peak, faerie_blessing
3:59.093 moonfire Fluffy_Pillow 159049.5/160000: 99% mana | 29.5/105: 28% eclipse lunar_peak, faerie_blessing
4:00.329 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -10.8/105: -10% eclipse faerie_blessing, mark_of_bleeding_hollow
4:01.976 use_item_nithramus_the_allseer Fluffy_Pillow 158889.5/160000: 99% mana | -61.1/105: -58% eclipse faerie_blessing, mark_of_bleeding_hollow
4:01.976 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -61.1/105: -58% eclipse faerie_blessing, nithramus, mark_of_bleeding_hollow
4:03.211 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -88.8/105: -85% eclipse solar_empowerment(3), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
4:04.528 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -103.8/105: -99% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
4:05.847 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -101.3/105: -96% eclipse solar_peak, solar_empowerment, starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
4:07.164 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -81.7/105: -78% eclipse solar_peak, starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
4:08.810 sunfire Fluffy_Pillow 158887.1/160000: 99% mana | -38.3/105: -37% eclipse solar_peak, starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
4:10.047 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 1.5/105: 1% eclipse starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
4:12.515 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 74.6/105: 71% eclipse faerie_blessing, nithramus
4:13.751 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 97.0/105: 92% eclipse lunar_empowerment(2), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
4:15.727 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 102.3/105: 97% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
4:17.702 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 69.4/105: 66% eclipse lunar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
4:18.940 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 34.3/105: 33% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
4:20.588 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -19.3/105: -18% eclipse lunar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
4:22.235 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -67.8/105: -65% eclipse lunar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
4:23.472 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -93.1/105: -89% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
4:24.790 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -104.8/105: -100% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
4:26.109 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -98.7/105: -94% eclipse lunar_empowerment(2), solar_peak, solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star
4:27.428 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -75.9/105: -72% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, sign_of_the_dark_star
4:28.664 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | -42.8/105: -41% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star
4:29.900 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -3.3/105: -3% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star
4:31.876 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 58.4/105: 56% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star
4:33.853 starsurge Fluffy_Pillow 159054.3/160000: 99% mana | 98.3/105: 94% eclipse solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star
4:35.090 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star
4:37.067 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 83.6/105: 80% eclipse lunar_empowerment, lunar_peak, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
4:39.044 moonfire Fluffy_Pillow 159054.3/160000: 99% mana | 31.1/105: 30% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
4:40.281 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -9.3/105: -9% eclipse solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
4:41.600 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -50.6/105: -48% eclipse solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
4:42.919 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -83.3/105: -79% eclipse solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
4:44.237 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -102.0/105: -97% eclipse solar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
4:45.473 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -103.8/105: -99% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow
4:46.790 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -88.8/105: -85% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
4:48.109 sunfire Fluffy_Pillow 158891.9/160000: 99% mana | -58.8/105: -56% eclipse solar_peak, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
4:49.346 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -21.4/105: -20% eclipse solar_empowerment, starfall, faerie_blessing
4:51.814 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 56.6/105: 54% eclipse solar_empowerment, starfall, faerie_blessing
4:54.282 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 102.3/105: 97% eclipse lunar_peak, solar_empowerment, starfall, faerie_blessing
4:55.518 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.6/105: 99% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment, starfall, faerie_blessing
4:57.494 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 74.4/105: 71% eclipse lunar_empowerment, lunar_peak, solar_empowerment, starfall, faerie_blessing
4:59.471 wrath Fluffy_Pillow 159054.3/160000: 99% mana | 17.4/105: 17% eclipse solar_empowerment, starfall, faerie_blessing
5:00.791 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -25.8/105: -25% eclipse starfall, faerie_blessing
5:02.439 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -72.8/105: -69% eclipse starfall, faerie_blessing
5:03.676 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -96.0/105: -91% eclipse solar_empowerment(3), starfall, faerie_blessing
5:04.997 wrath Fluffy_Pillow 158896.7/160000: 99% mana | -105.0/105: -100% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing
5:06.315 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -96.2/105: -92% eclipse solar_peak, solar_empowerment, starfall, faerie_blessing
5:07.633 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -71.1/105: -68% eclipse solar_peak, starfall, faerie_blessing
5:08.869 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | -36.5/105: -35% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing
5:10.105 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 3.5/105: 3% eclipse solar_empowerment(3), starfall, faerie_blessing
5:12.575 starsurge Fluffy_Pillow 159054.3/160000: 99% mana | 76.0/105: 72% eclipse solar_empowerment(3), starfall, faerie_blessing
5:13.811 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 97.8/105: 93% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing
5:15.787 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 101.8/105: 97% eclipse lunar_empowerment, lunar_peak, solar_empowerment(3), starfall, faerie_blessing
5:17.762 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 67.9/105: 65% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
5:18.998 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 32.5/105: 31% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(3), starfall, faerie_blessing
5:20.234 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -7.7/105: -7% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing
5:21.551 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -49.2/105: -47% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing
5:22.869 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -82.3/105: -78% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing
5:24.188 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -101.6/105: -97% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
5:25.423 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -104.1/105: -99% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(3), starfall, faerie_blessing
5:26.742 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -89.7/105: -85% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
5:28.059 sunfire Fluffy_Pillow 158887.1/160000: 99% mana | -60.1/105: -57% eclipse lunar_empowerment(2), solar_peak, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
5:29.296 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -23.0/105: -22% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
5:31.271 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 40.8/105: 39% eclipse lunar_empowerment, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
5:33.247 starsurge Fluffy_Pillow 159051.9/160000: 99% mana | 89.5/105: 85% eclipse solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
5:34.483 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.6/105: 99% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
5:36.459 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 94.2/105: 90% eclipse lunar_empowerment, lunar_peak, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
5:38.434 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 49.6/105: 47% eclipse lunar_peak, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
5:40.903 wrath Fluffy_Pillow 159051.9/160000: 99% mana | -29.4/105: -28% eclipse solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
5:42.222 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -67.5/105: -64% eclipse starfall, faerie_blessing, mark_of_bleeding_hollow
5:43.871 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -98.5/105: -94% eclipse starfall, faerie_blessing, mark_of_bleeding_hollow
5:45.518 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -103.6/105: -99% eclipse solar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
5:47.164 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -81.7/105: -78% eclipse solar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:48.811 sunfire Fluffy_Pillow 158889.5/160000: 99% mana | -38.3/105: -36% eclipse solar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:50.050 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 1.6/105: 2% eclipse faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:52.517 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 74.6/105: 71% eclipse faerie_blessing, sign_of_the_dark_star
5:54.985 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 105.0/105: 100% eclipse lunar_peak, faerie_blessing, sign_of_the_dark_star
5:57.453 moonfire Fluffy_Pillow 159049.5/160000: 99% mana | 75.3/105: 72% eclipse lunar_peak, faerie_blessing, sign_of_the_dark_star
5:58.689 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 42.0/105: 40% eclipse faerie_blessing, sign_of_the_dark_star
5:59.925 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 2.5/105: 2% eclipse lunar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star
6:01.573 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -49.8/105: -47% eclipse lunar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star
6:02.808 use_item_nithramus_the_allseer Fluffy_Pillow 160000.0/160000: 100% mana | -81.1/105: -77% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star
6:02.808 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -81.1/105: -77% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing, nithramus, sign_of_the_dark_star
6:04.126 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -101.1/105: -96% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(2), starfall, faerie_blessing, nithramus, sign_of_the_dark_star
6:05.445 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -104.0/105: -99% eclipse lunar_empowerment(2), solar_peak, solar_empowerment, starfall, faerie_blessing, nithramus, sign_of_the_dark_star
6:06.765 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -89.3/105: -85% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, nithramus
6:08.410 sunfire Fluffy_Pillow 158884.8/160000: 99% mana | -50.3/105: -48% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, nithramus
6:09.648 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -11.6/105: -11% eclipse lunar_empowerment(2), starfall, faerie_blessing, nithramus
6:11.622 incarnation Fluffy_Pillow 159047.1/160000: 99% mana | 51.2/105: 49% eclipse lunar_empowerment, starfall, faerie_blessing, nithramus
6:12.859 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 82.1/105: 78% eclipse incarnation, lunar_empowerment, starfall, faerie_blessing, nithramus
6:12.859 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 82.1/105: 78% eclipse incarnation, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, nithramus
6:14.835 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 82.1/105: 78% eclipse incarnation, celestial_alignment, faerie_blessing, nithramus
6:17.304 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 82.1/105: 78% eclipse incarnation, celestial_alignment, faerie_blessing, nithramus
6:19.772 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 82.1/105: 78% eclipse incarnation, celestial_alignment, faerie_blessing
6:22.241 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 82.1/105: 78% eclipse incarnation, celestial_alignment, faerie_blessing
6:24.709 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 82.1/105: 78% eclipse incarnation, celestial_alignment, faerie_blessing
6:25.945 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 82.1/105: 78% eclipse incarnation, celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing
6:27.592 moonfire Fluffy_Pillow 158889.5/160000: 99% mana | 82.1/105: 78% eclipse incarnation, celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing
6:28.830 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 98.0/105: 93% eclipse incarnation, lunar_empowerment(2), starfall, faerie_blessing
6:30.806 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 101.7/105: 97% eclipse incarnation, lunar_empowerment, lunar_peak, starfall, faerie_blessing
6:32.781 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 67.4/105: 64% eclipse incarnation, lunar_peak, starfall, faerie_blessing
6:34.019 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 31.9/105: 30% eclipse incarnation, lunar_empowerment(2), lunar_peak, starfall, faerie_blessing
6:35.664 wrath Fluffy_Pillow 158884.8/160000: 99% mana | -21.7/105: -21% eclipse incarnation, lunar_empowerment(2), starfall, faerie_blessing
6:37.310 starsurge Fluffy_Pillow 158887.1/160000: 99% mana | -69.7/105: -66% eclipse incarnation, lunar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
6:38.546 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -94.2/105: -90% eclipse incarnation, lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow
6:39.865 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -104.9/105: -100% eclipse incarnation, lunar_empowerment(2), solar_peak, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
6:41.183 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -97.8/105: -93% eclipse incarnation, lunar_empowerment(2), solar_peak, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
6:42.501 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -74.2/105: -71% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
6:44.150 sunfire Fluffy_Pillow 158894.3/160000: 99% mana | -27.7/105: -26% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
6:45.387 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 12.7/105: 12% eclipse lunar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
6:47.363 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 71.0/105: 68% eclipse lunar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
6:49.339 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 102.7/105: 98% eclipse lunar_peak, starfall, faerie_blessing, sign_of_the_dark_star
6:51.809 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 88.5/105: 84% eclipse lunar_peak, faerie_blessing, sign_of_the_dark_star
6:54.277 wrath Fluffy_Pillow 159049.5/160000: 99% mana | 23.6/105: 23% eclipse lunar_peak, faerie_blessing, sign_of_the_dark_star
6:55.924 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -30.1/105: -29% eclipse faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:57.570 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -75.9/105: -72% eclipse faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:59.217 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -101.8/105: -97% eclipse solar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
7:00.866 starsurge Fluffy_Pillow 158894.3/160000: 99% mana | -101.1/105: -96% eclipse solar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
7:02.103 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -82.9/105: -79% eclipse solar_peak, solar_empowerment(3), starfall, sign_of_the_dark_star, mark_of_bleeding_hollow
7:03.422 sunfire Fluffy_Pillow 158891.9/160000: 99% mana | -49.9/105: -48% eclipse solar_peak, solar_empowerment(2), starfall, sign_of_the_dark_star, mark_of_bleeding_hollow
7:04.659 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -11.2/105: -11% eclipse solar_empowerment(2), starfall, sign_of_the_dark_star, mark_of_bleeding_hollow
7:07.127 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 65.1/105: 62% eclipse solar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
7:08.364 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 91.4/105: 87% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star
7:10.338 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 104.4/105: 99% eclipse lunar_empowerment, lunar_peak, solar_empowerment(2), starfall, faerie_blessing
7:12.315 starsurge Fluffy_Pillow 159054.3/160000: 99% mana | 78.4/105: 75% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
7:13.553 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 46.1/105: 44% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(2), starfall, faerie_blessing
7:14.790 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 6.9/105: 7% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing
7:16.111 wrath Fluffy_Pillow 158896.7/160000: 99% mana | -35.9/105: -34% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing
7:17.431 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -72.6/105: -69% eclipse lunar_empowerment(2), starfall, faerie_blessing
7:19.078 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -100.6/105: -96% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
7:20.727 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -102.3/105: -97% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
7:22.373 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -77.1/105: -73% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
7:24.020 sunfire Fluffy_Pillow 158889.5/160000: 99% mana | -31.8/105: -30% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 653 622 622
Agility 1352 1288 1288
Stamina 8105 7369 7369
Intellect 6186 5630 5414 (4320)
Spirit 782 782 782
Health 486300 442140 0
Mana 160000 160000 0
Eclipse 105 105 0
Spell Power 9475 8058 2428
Crit 15.72% 10.72% 629
Haste 21.71% 15.91% 1329
Multistrike 16.03% 11.03% 728
Damage / Heal Versatility 4.75% 1.75% 228
ManaReg per Second 2379 640 0
Attack Power 1487 1288 0
Mastery 126.00% 109.88% 3955
Armor 4158 1386 1386

Gear

Source Slot Average Item Level: 734.00
Local Head Oathclaw Helm
ilevel: 735, stats: { 190 Armor, +444 AgiInt, +667 Sta, +359 Mastery, +232 Crit }
Local Neck Vial of Immiscible Liquid
ilevel: 725, stats: { +228 Int, +342 Sta, +204 Mastery, +100 Crit }, enchant: { +75 Mastery }
Local Shoulders Oathclaw Mantle
ilevel: 720, stats: { 161 Armor, +290 AgiInt, +435 Sta, +251 Mastery, +135 Haste }
Local Chest Oathclaw Vestment
ilevel: 726, stats: { 222 Armor, +409 AgiInt, +613 Sta, +342 Haste, +202 Mastery }
Local Waist Waistwrap of Banishment
ilevel: 736, stats: { 132 Armor, +337 AgiInt, +505 Sta, +301 Mult, +147 Mastery }, gems: { +75 Mastery }
Local Legs Oathclaw Leggings
ilevel: 720, stats: { 188 Armor, +387 AgiInt, +580 Sta, +301 Mult, +213 Mastery }
Local Feet Supple Boots of the Peerless
ilevel: 725, stats: { 152 Armor, +456 Sta, +304 AgiInt, +178 Crit, +217 Mastery }
Local Wrists Gorebound Wristguards
ilevel: 730, stats: { 99 Armor, +238 AgiInt, +357 Sta, +193 Mastery, +125 Haste }
Local Hands Felfinger Runegloves
ilevel: 745, stats: { 155 Armor, +366 AgiInt, +548 Sta, +348 Haste, +139 Mastery }
Local Finger1 Loathful Encrusted Band
ilevel: 725, stats: { +228 Int, +342 Sta, +178 Mastery, +126 Mult }, enchant: { +50 Mastery }
Local Finger2 Nithramus, the All-Seer
ilevel: 795, stats: { +437 Int, +656 Sta, +328 Mastery, +228 Vers }, enchant: { +50 Mastery }
Local Trinket1 Seed of Creation
ilevel: 736
Local Trinket2 Desecrated Shadowmoon Insignia
ilevel: 736, stats: { +555 Mastery }
Local Back Brilliant Hexweave Cloak of the Peerless
ilevel: 725, stats: { 87 Armor, +228 Int, +342 Sta, +119 Crit, +171 Mastery }, enchant: { +100 Mastery }
Local Main Hand Edict of Argus
ilevel: 730, weapon: { 883 - 1326, 2.9 }, stats: { +424 Int, +636 Sta, +379 Haste, +185 Mastery, +2428 SP }, gems: { +75 Mastery }, enchant: mark_of_bleeding_hollow

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Balance Druid) Mass Entanglement Typhoon
60 Soul of the Forest Incarnation: Chosen of Elune Force of Nature
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil
100 Euphoria Stellar Flare Balance of Power

Profile

druid="Arbek"
origin="https://eu.api.battle.net/wow/character/arathor/Arbek/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hellfire/190/143122622-avatar.jpg"
level=100
race=night_elf
timeofday=night
role=spell
position=back
professions=tailoring=700/inscription=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!1101220
glyphs=stampeding_roar/rebirth/astral_communion/untamed_stars/stars/grace
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_sushi
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/incarnation
actions.precombat+=/starfire

# Executed every time the actor is available.

actions=force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
actions+=/call_action_list,name=cooldowns,if=cooldown.celestial_alignment.up&(eclipse_energy>=0|target.time_to_die<=30+gcd)
actions+=/use_item,slot=finger2
actions+=/call_action_list,name=ca_aoe,if=buff.celestial_alignment.up&spell_targets.starfall_pulse>1&!t18_class_trinket
actions+=/call_action_list,name=ca,if=buff.celestial_alignment.up&(spell_targets.starfall_pulse=1|t18_class_trinket)
actions+=/call_action_list,name=aoe_t18_trinket,if=buff.celestial_alignment.down&spell_targets.starfall.pulse>1&t18_class_trinket
actions+=/call_action_list,name=aoe,if=spell_targets.starfall_pulse>1&buff.celestial_alignment.down&!t18_class_trinket
actions+=/call_action_list,name=single_target,if=spell_targets.starfall_pulse=1&buff.celestial_alignment.down

actions.single_target=starsurge,if=charges=3
actions.single_target+=/starsurge,if=buff.lunar_empowerment.down&eclipse_energy>40
actions.single_target+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
actions.single_target+=/sunfire,if=!talent.balance_of_power.enabled&((remains<solar_max&eclipse_dir.solar)|(buff.solar_peak.up&buff.solar_peak.remains<action.wrath.cast_time))
actions.single_target+=/sunfire,if=talent.balance_of_power.enabled&(remains<lunar_max+10|remains<action.wrath.cast_time)
actions.single_target+=/stellar_flare,if=remains<7
actions.single_target+=/moonfire,if=!talent.euphoria.enabled&!talent.balance_of_power.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+20))
actions.single_target+=/moonfire,if=talent.euphoria.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+10))
actions.single_target+=/moonfire,if=talent.balance_of_power.enabled&(remains<solar_max+10|remains<action.starfire.cast_time)
actions.single_target+=/wrath,if=(eclipse_energy<0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.single_target+=/starfire

actions.aoe=sunfire,cycle_targets=1,if=remains<8
actions.aoe+=/starfall,if=spell_targets.starfall_pulse>2&buff.starfall.remains<3
actions.aoe+=/starfall,if=@eclipse_energy<20&eclipse_dir.lunar&buff.starfall.remains<3&talent.euphoria.enabled
actions.aoe+=/starfall,if=@eclipse_energy<10&eclipse_dir.lunar&buff.starfall.remains<3&!talent.euphoria.enabled
actions.aoe+=/moonfire,cycle_targets=1,if=remains<12
actions.aoe+=/stellar_flare,cycle_targets=1,if=remains<7
actions.aoe+=/starsurge,if=(buff.lunar_empowerment.down&eclipse_energy>40&charges>1)|charges=3
actions.aoe+=/starsurge,if=(buff.solar_empowerment.down&eclipse_energy<-40&charges>1)|charges=3
actions.aoe+=/wrath,if=(eclipse_energy<=0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.aoe+=/starfire

actions.ca=starsurge,if=(buff.lunar_empowerment.down&eclipse_energy>=0)|(buff.solar_empowerment.down&eclipse_energy<0)
actions.ca+=/moonfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
actions.ca+=/sunfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
actions.ca+=/starfire,if=eclipse_energy>=0&buff.celestial_alignment.remains>cast_time
actions.ca+=/wrath,if=buff.celestial_alignment.remains>cast_time
actions.ca+=/moonfire,cycle_targets=1
actions.ca+=/sunfire,cycle_targets=1

actions.ca_aoe=starfall,if=buff.starfall.remains<3
actions.ca_aoe+=/moonfire,cycle_targets=1,if=!dot.moonfire.ticking|!dot.sunfire.ticking
actions.ca_aoe+=/sunfire,cycle_targets=1,if=!dot.moonfire.ticking|!dot.sunfire.ticking
actions.ca_aoe+=/starsurge,if=buff.lunar_empowerment.down&eclipse_energy>=0&charges>1
actions.ca_aoe+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<0&charges>1
actions.ca_aoe+=/starfire,if=eclipse_energy>=0&buff.celestial_alignment.remains>cast_time
actions.ca_aoe+=/wrath,if=buff.celestial_alignment.remains>cast_time
actions.ca_aoe+=/moonfire,cycle_targets=1
actions.ca_aoe+=/sunfire,cycle_targets=1

actions.aoe_t18_trinket=starsurge,if=charges=3
actions.aoe_t18_trinket+=/sunfire,cycle_targets=1,if=remains<8
actions.aoe_t18_trinket+=/moonfire,cycle_targets=1,if=remains<12
actions.aoe_t18_trinket+=/starsurge,if=eclipse_energy>40&buff.lunar_empowerment.down
actions.aoe_t18_trinket+=/starsurge,if=eclipse_energy<-40&buff.solar_empowerment.down
actions.aoe_t18_trinket+=/wrath,if=(eclipse_energy<0&action.starfire.cast_time<eclipse_change)|(eclipse_energy>0&cast_time>eclipse_change)
actions.aoe_t18_trinket+=/starfire

actions.cooldowns=incarnation
actions.cooldowns+=/potion,name=draenic_intellect
actions.cooldowns+=/celestial_alignment

head=oathclaw_helm,id=124261,bonus_id=567,upgrade=2
neck=vial_of_immiscible_liquid,id=124212,bonus_id=566,upgrade=2,enchant=75mastery
shoulders=oathclaw_mantle,id=124272,bonus_id=566,upgrade=2
back=brilliant_hexweave_cloak,id=114819,bonus_id=46/538/618,upgrade=2,enchant=gift_of_mastery
chest=oathclaw_vestment,id=124246,bonus_id=561/566,upgrade=2
wrists=gorebound_wristguards,id=124278,bonus_id=567,upgrade=2
hands=felfinger_runegloves,id=124254,bonus_id=567,upgrade=2
waist=waistwrap_of_banishment,id=124276,bonus_id=561/564/566,upgrade=2,gems=75mastery
legs=oathclaw_leggings,id=124267,bonus_id=566,upgrade=2
feet=supple_boots,id=116182,bonus_id=50/536/618,upgrade=2
finger1=loathful_encrusted_band,id=124192,bonus_id=566,upgrade=2,enchant=50mastery
finger2=nithramus_the_allseer,id=124635,bonus_id=641/650,enchant=50mastery
trinket1=seed_of_creation,id=124514,bonus_id=561/566,upgrade=2
trinket2=desecrated_shadowmoon_insignia,id=124228,bonus_id=562/567,upgrade=2
main_hand=edict_of_argus,id=124382,bonus_id=564/566,upgrade=2,gems=75mastery,enchant=mark_of_bleeding_hollow

# Gear Summary
# gear_ilvl=733.93
# gear_stamina=6479
# gear_intellect=4320
# gear_spell_power=2428
# gear_crit_rating=629
# gear_haste_rating=1329
# gear_mastery_rating=3767
# gear_multistrike_rating=728
# gear_versatility_rating=228
# gear_armor=1386
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1

Töpszfix

Töpszfix : 74049 dps, 74049 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
74049.0 74049.0 31.5 / 0.043% 10008.6 / 13.5% 94.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
716.4 716.4 Mana 0.00% 42.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/arathor/Töpszfix/advanced
Talents
  • 15: Displacer Beast
  • 30: Ysera's Gift
  • 45: Mass Entanglement
  • 60: Soul of the Forest
  • 75: Mighty Bash
  • 90: Heart of the Wild
  • 100: Euphoria
  • Talent Calculator
Glyphs
  • Glyph of Moonwarding
  • Glyph of Rebirth
  • Glyph of Entangling Energy
  • Glyph of the Chameleon
  • Glyph of Stars
  • Glyph of Untamed Stars
Professions
  • leatherworking: 700
  • skinning: 715

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Töpszfix 74049
Moonfire 7198 9.7% 12.7 36.65sec 255594 237485 Direct 12.8 15555 31138 17787 14.3% 3.3 4666 9319 14.2%  
Periodic 315.5 7694 15395 8794 14.3% 81.7 2307 4617 14.3% 98.4%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.66 12.79 315.51 315.51 1.0763 1.4041 3235258.26 3235258.26 0.00 7085.17 237485.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.47 14.20% 9319.21 4424 16814 3500.95 0 16814 4389 4389 0.00
multistrike 2.85 85.80% 4665.87 2195 8407 4419.61 0 8407 13282 13282 0.00
hit 10.95 85.68% 15555.17 7315 28024 15535.76 8910 18859 170406 170406 0.00
crit 1.83 14.32% 31138.40 14634 56048 26697.92 0 56048 57012 57012 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.7 14.31% 4616.86 4 12137 4621.24 2193 9955 54003 54003 0.00
multistrike 70.0 85.69% 2306.53 11 6069 2307.97 1773 2938 161558 161558 0.00
hit 270.4 85.71% 7693.70 3 20229 7698.73 7127 8289 2080589 2080589 0.00
crit 45.1 14.29% 15395.13 5 40458 15403.98 10685 20747 694019 694019 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:480.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that burns the enemy for {$164812s1=1 + 41.2%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.412340
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.297648
  • base_td:0.00
  • dot_duration:40.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Starfall 0 (5762) 0.0% (7.8%) 45.2 10.08sec 57273 0

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.21 45.21 349.25 349.25 0.0000 0.9894 0.00 0.00 0.00 7493.17 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 299.3 85.69% 0.00 0 0 0.00 0 0 0 0 0.00
crit 50.0 14.31% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:48505
  • name:Starfall
  • school:arcane
  • tooltip:
  • description:A Lunar spell that strikes all enemies{$?s146655=true}[][ afflicted by your Moonfire or Sunfire] within $50286a yards. Deals {$50288s1=0 + 29.7%} Arcane damage every $184989t1 sec for {$184989d=10 seconds}. Max 3 charges. Charges are shared with Starsurge. Shapeshifting into an animal form or losing control of your character will cancel the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Starfall (_pulse) 5762 7.8% 349.3 1.28sec 7414 0 Periodic 348.1 6037 12077 6901 14.3% 90.3 1811 3624 14.3% 0.0%

Stats details: starfall_pulse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 349.25 0.00 0.00 348.11 0.0000 0.0000 2589265.84 2589265.84 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 12.9 14.31% 3624.32 2063 6051 3629.06 2228 5327 46813 46813 0.00
multistrike 77.4 85.69% 1810.57 1032 3026 1812.78 1553 2177 140057 140057 0.00
hit 298.3 85.69% 6037.09 3439 10086 6044.63 5545 6627 1800821 1800821 0.00
crit 49.8 14.31% 12076.90 6877 20171 12092.60 9957 14847 601575 601575 0.00
 
 

Action details: starfall_pulse

Static Values
  • id:50288
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50288
  • name:Starfall
  • school:arcane
  • tooltip:
  • description:{$@spelldesc48505=A Lunar spell that strikes all enemies{$?s146655=true}[][ afflicted by your Moonfire or Sunfire] within $50286a yards. Deals {$50288s1=0 + 29.7%} Arcane damage every $184989t1 sec for {$184989d=10 seconds}. Max 3 charges. Charges are shared with Starsurge. Shapeshifting into an animal form or losing control of your character will cancel the effect.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.296800
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Starfire 21950 29.6% 109.5 4.10sec 90119 48427 Direct 109.5 73153 146357 83629 14.3% 28.3 21946 43933 14.2%  

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.50 109.50 0.00 0.00 1.8609 0.0000 9867919.60 9867919.60 0.00 48427.23 48427.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.03 14.22% 43933.06 22495 70387 43061.35 0 70387 177125 177125 0.00
multistrike 24.31 85.78% 21945.74 9761 35194 21963.43 16839 27670 533562 533562 0.00
hit 93.83 85.69% 73153.11 32537 117312 73217.01 65390 81776 6863843 6863843 0.00
crit 15.67 14.31% 146356.52 68979 234624 146519.90 106600 202547 2293390 2293390 0.00
 
 

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that causes {$s1=1 + 238.1%} Arcane damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.380760
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starsurge 10729 14.5% 52.5 8.70sec 91886 85153 Direct 52.3 74760 149514 85447 14.3% 13.6 22424 44827 14.3%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.46 52.34 0.00 0.00 1.0791 0.0000 4820166.58 4820166.58 0.00 85152.93 85152.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.94 14.27% 44826.98 31770 60687 38238.20 0 60687 86855 86855 0.00
multistrike 11.64 85.73% 22423.82 15876 30344 22448.98 19096 30344 260920 260920 0.00
hit 44.86 85.70% 74760.34 52865 101145 74835.79 70735 81251 3353645 3353645 0.00
crit 7.48 14.30% 149514.25 105815 202291 149533.26 0 202291 1118746 1118746 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:
  • description:Instantly causes {$78674s1=7647} Spellstorm damage to the target, benefiting from your strongest current Eclipse bonus. Also grants Lunar or Solar Empowerment, based on current Balance Energy side, which increases the damage of your next $164547n Starfires or $164545n Wraths by {$164545s1=30}%. Max 3 charges. Charges shared with Starfall.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.976480
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Sunfire 7474 10.1% 19.1 22.24sec 176285 162419 Direct 23.7 15923 31843 18205 14.3% 6.1 4770 9564 14.2%  
Periodic 315.9 7444 14882 8508 14.3% 81.8 2233 4471 14.3% 98.4%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.07 23.73 315.88 315.88 1.0854 1.4016 3361754.95 3361754.95 0.00 7254.18 162419.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.87 14.22% 9563.79 4391 15032 5598.76 0 15032 8356 8356 0.00
multistrike 5.27 85.78% 4769.88 2195 7516 4743.95 0 6488 25136 25136 0.00
hit 20.33 85.66% 15922.76 7314 25054 15911.28 12990 17800 323670 323670 0.00
crit 3.40 14.34% 31842.96 14647 50108 30902.69 0 43140 108340 108340 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.7 14.28% 4470.60 2 10851 4471.67 1972 9043 52253 52253 0.00
multistrike 70.1 85.72% 2233.06 1 5426 2233.57 1685 2798 156650 156650 0.00
hit 270.7 85.70% 7443.58 3 18085 7445.38 6965 7960 2014960 2014960 0.00
crit 45.2 14.30% 14881.93 7 36170 14885.82 10575 19812 672390 672390 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1056.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.balance_of_power.enabled&((remains<solar_max&eclipse_dir.solar)|(buff.solar_peak.up&buff.solar_peak.remains<action.wrath.cast_time))
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every {$t2=0} seconds.
  • description:A Solar spell that burns the enemy for {$164815s1=1060} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[ to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.412340
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.297648
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Wrath 14524 19.6% 121.2 3.52sec 53893 42181 Direct 120.7 43927 87878 50202 14.3% 31.3 13180 26367 14.3%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.16 120.67 0.00 0.00 1.2777 0.0000 6529896.08 6529896.08 0.00 42181.16 42181.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.48 14.29% 26366.80 14103 43998 26055.10 0 43998 118059 118059 0.00
multistrike 26.86 85.71% 13180.36 6652 21999 13187.58 10771 16068 354023 354023 0.00
hit 103.44 85.72% 43927.23 22174 73330 43954.14 38489 49279 4543862 4543862 0.00
crit 17.23 14.28% 87878.05 44349 146661 87938.81 69493 110047 1513952 1513952 0.00
 
 

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy<0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:
  • description:A Solar spell that causes {$s1=3823} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.488240
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - fey_moonwing 8820 / 6412
Fey Missile 8820 8.7% 489.4 0.88sec 5898 4138 Direct 487.3 4808 9616 5496 14.3% 126.3 1442 2885 14.3%  

Stats details: fey_missile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 489.44 487.33 0.00 0.00 1.4252 0.0000 2886625.48 2886625.48 0.00 4138.19 4138.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 18.06 14.30% 2884.93 2859 3198 2885.26 2859 3063 52115 52115 0.00
multistrike 108.26 85.70% 1442.43 1430 1599 1442.60 1430 1496 156154 156154 0.00
hit 417.62 85.70% 4808.16 4766 5330 4808.72 4770 4912 2007994 2007994 0.00
crit 69.71 14.30% 9616.29 9531 10661 9617.32 9531 9914 670363 670363 0.00
 
 

Action details: fey_missile

Static Values
  • id:188046
  • school:spellstorm
  • resource:none
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.600
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188046
  • name:Fey Missile
  • school:spellstorm
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.603155
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Töpszfix
Celestial Alignment 3.0 188.52sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.56 85.57% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.43 14.43% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:112071
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:112071
  • name:Celestial Alignment
  • school:physical
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
 
Draenic Intellect Potion (potion) 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: potion

Static Values
  • id:156426
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your Intellect by {$s1=1000} for {$d=25 seconds}.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.86 85.66% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.14 14.34% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2976.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.03% 10.20% 0.0(0.0)

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 3.0 0.0 184.8sec 188.5sec 9.95% 9.65% 0.0(0.0)

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • celestial_alignment_1:9.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
Draenic Intellect Potion 2.0 0.0 181.0sec 0.0sec 10.84% 10.85% 0.0(0.0)

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:10.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your Intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Faerie Blessing 3.7 29.5 114.4sec 13.1sec 93.70% 93.70% 29.5(29.5)

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_faerie_blessing
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faerie_blessing_1:93.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188086
  • name:Faerie Blessing
  • tooltip:Arcane and Nature damage increased by $w1%.
  • description:{$@spelldesc187877=When a Faerie Dragon is summoned, your Arcane and Nature damage is increased by $188086m1% for {$188086d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 29.2 0.4 15.4sec 15.5sec 49.96% 49.91% 0.4(0.6)

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_lunar_empowerment
  • max_stacks:2
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lunar_empowerment_1:22.01%
  • lunar_empowerment_2:27.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Starfire is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Starfires within {$d=40 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Lunar Peak 20.6 0.0 21.4sec 21.4sec 21.34% 24.15% 0.0(0.0)

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_lunar_peak
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lunar_peak_1:21.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171743
  • name:Lunar Peak
  • tooltip:Increases the direct damage of your next Moonfire by {$s1=100}%.
  • description:{$@spelldesc8921=A Lunar spell that burns the enemy for {$164812s1=1 + 41.2%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 22.2 0.6 19.1sec 18.6sec 51.48% 53.21% 0.6(1.0)

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • solar_empowerment_1:11.51%
  • solar_empowerment_2:16.95%
  • solar_empowerment_3:23.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Wraths within {$d=40 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Peak 20.0 0.0 21.4sec 21.4sec 19.67% 23.86% 0.0(0.0)

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_solar_peak
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • solar_peak_1:19.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171744
  • name:Solar Peak
  • tooltip:Increases the direct damage of your next Sunfire by {$s1=100}%.
  • description:{$@spelldesc93402=A Solar spell that burns the enemy for {$164815s1=1060} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[ to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Starfall 13.4 31.9 34.4sec 10.1sec 76.90% 76.91% 357.3(357.3)

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • starfall_1:76.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184989
  • name:Starfall
  • tooltip:Summoning stars from the sky.
  • description:{$@spelldesc48505=A Lunar spell that strikes all enemies{$?s146655=true}[][ afflicted by your Moonfire or Sunfire] within $50286a yards. Deals {$50288s1=0 + 29.7%} Arcane damage every $184989t1 sec for {$184989d=10 seconds}. Max 3 charges. Charges are shared with Starsurge. Shapeshifting into an animal form or losing control of your character will cancel the effect.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Stance of the Fierce Tiger (fierce_tiger_movement_aura)

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_fierce_tiger_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fierce_tiger_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:
  • description:Increases all damage dealt by {$s3=10}%. Grants you and your allies within $m7 yards {$166646s1=10}% increased movement speed, and improves the functionality of Jab, Expel Harm, Tiger Palm, Blackout Kick, and Rising Sun Kick.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Draenic Intellect Flask

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
Moonkin Form

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
sleeper_sushi_food

Buff details

  • buff initial source:Töpszfix
  • cooldown name:buff_sleeper_sushi_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:125.00

Stack Uptimes

  • sleeper_sushi_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Töpszfix
moonfire Mana 12.8 6137.3 480.0 484.9 527.1
starfire Mana 109.5 105118.5 960.0 960.0 93.9
starsurge Mana 52.5 50360.3 960.0 960.0 95.7
sunfire Mana 23.7 25058.8 1056.0 1314.0 134.2
wrath Mana 121.2 135702.4 1120.0 1120.0 48.1
Resource Gains Type Count Total Average Overflow
energy_regen Energy 892.21 0.00 (0.00%) 0.00 6379.99 100.00%
mp5_regen Mana 892.21 321697.94 (100.00%) 360.56 805886.36 71.47%
Resource RPS-Gain RPS-Loss
Mana 714.87 716.38
Combat End Resource Mean Min Max
Mana 159319.35 157348.97 160000.00
Eclipse -10.85 -105.00 105.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 42.9%

Procs

Count Interval
Shooting Stars overflow (buff already up) 0.2 90.8sec
Shooting Stars 36.1 12.2sec
Starshards 45.2 10.0sec
wrong_eclipse_wrath 0.0 226.4sec
wrong_eclipse_starfire 4.9 76.2sec

Statistics & Data Analysis

Fight Length
Sample Data Töpszfix Fight Length
Count 24999
Mean 450.01
Minimum 351.82
Maximum 558.10
Spread ( max - min ) 206.27
Range [ ( max - min ) / 2 * 100% ] 22.92%
DPS
Sample Data Töpszfix Damage Per Second
Count 24999
Mean 74048.97
Minimum 64765.60
Maximum 84460.16
Spread ( max - min ) 19694.56
Range [ ( max - min ) / 2 * 100% ] 13.30%
Standard Deviation 2539.7788
5th Percentile 69946.10
95th Percentile 78346.73
( 95th Percentile - 5th Percentile ) 8400.62
Mean Distribution
Standard Deviation 16.0633
95.00% Confidence Intervall ( 74017.48 - 74080.45 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4519
0.1 Scale Factor Error with Delta=300 55064
0.05 Scale Factor Error with Delta=300 220259
0.01 Scale Factor Error with Delta=300 5506497
Priority Target DPS
Sample Data Töpszfix Priority Target Damage Per Second
Count 24999
Mean 74048.97
Minimum 64765.60
Maximum 84460.16
Spread ( max - min ) 19694.56
Range [ ( max - min ) / 2 * 100% ] 13.30%
Standard Deviation 2539.7788
5th Percentile 69946.10
95th Percentile 78346.73
( 95th Percentile - 5th Percentile ) 8400.62
Mean Distribution
Standard Deviation 16.0633
95.00% Confidence Intervall ( 74017.48 - 74080.45 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4519
0.1 Scale Factor Error with Delta=300 55064
0.05 Scale Factor Error with Delta=300 220259
0.01 Scale Factor Error with Delta=300 5506497
DPS(e)
Sample Data Töpszfix Damage Per Second (Effective)
Count 24999
Mean 74048.97
Minimum 64765.60
Maximum 84460.16
Spread ( max - min ) 19694.56
Range [ ( max - min ) / 2 * 100% ] 13.30%
Damage
Sample Data Töpszfix Damage
Count 24999
Mean 30404261.31
Minimum 22002562.80
Maximum 39917838.66
Spread ( max - min ) 17915275.86
Range [ ( max - min ) / 2 * 100% ] 29.46%
DTPS
Sample Data Töpszfix Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Töpszfix Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Töpszfix Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Töpszfix Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Töpszfix Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Töpszfix Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data TöpszfixTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Töpszfix Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_sushi
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 moonkin_form
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 incarnation
7 0.00 starfire
Default action list Executed every time the actor is available.
# count action,conditions
0.00 force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
8 0.00 call_action_list,name=cooldowns,if=cooldown.celestial_alignment.up&(eclipse_energy>=0|target.time_to_die<=30+gcd)
9 0.00 call_action_list,name=ca_aoe,if=buff.celestial_alignment.up&spell_targets.starfall_pulse>1&!t18_class_trinket
A 0.00 call_action_list,name=ca,if=buff.celestial_alignment.up&(spell_targets.starfall_pulse=1|t18_class_trinket)
B 0.00 call_action_list,name=aoe_t18_trinket,if=buff.celestial_alignment.down&spell_targets.starfall.pulse>1&t18_class_trinket
C 0.00 call_action_list,name=aoe,if=spell_targets.starfall_pulse>1&buff.celestial_alignment.down&!t18_class_trinket
D 0.00 call_action_list,name=single_target,if=spell_targets.starfall_pulse=1&buff.celestial_alignment.down
actions.single_target
# count action,conditions
E 2.31 starsurge,if=charges=3
F 21.12 starsurge,if=buff.lunar_empowerment.down&eclipse_energy>40
G 21.40 starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
H 18.94 sunfire,if=!talent.balance_of_power.enabled&((remains<solar_max&eclipse_dir.solar)|(buff.solar_peak.up&buff.solar_peak.remains<action.wrath.cast_time))
0.00 sunfire,if=talent.balance_of_power.enabled&(remains<lunar_max+10|remains<action.wrath.cast_time)
0.00 stellar_flare,if=remains<7
0.00 moonfire,if=!talent.euphoria.enabled&!talent.balance_of_power.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+20))
I 8.00 moonfire,if=talent.euphoria.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+10))
0.00 moonfire,if=talent.balance_of_power.enabled&(remains<solar_max+10|remains<action.starfire.cast_time)
J 119.41 wrath,if=(eclipse_energy<0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
K 91.07 starfire
actions.ca
# count action,conditions
L 7.63 starsurge,if=(buff.lunar_empowerment.down&eclipse_energy>=0)|(buff.solar_empowerment.down&eclipse_energy<0)
M 2.15 moonfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
N 0.05 sunfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
O 17.78 starfire,if=eclipse_energy>=0&buff.celestial_alignment.remains>cast_time
P 2.18 wrath,if=buff.celestial_alignment.remains>cast_time
Q 2.51 moonfire,cycle_targets=1
R 0.08 sunfire,cycle_targets=1
actions.cooldowns
# count action,conditions
0.00 incarnation
S 1.00 potion,name=draenic_intellect
T 3.00 celestial_alignment

Sample Sequence

01357TLMOOLOOLOOLOQKKKKKKJJJJJJJJHKFKKFKKJJJJJJHKKKKFJJGJJJGJHIKKKKJJJJJJJHKFKKFKJJGJJJJHKIKFKKJJGJJJGJHKFKKKJJJJJJJGKEIKKFKHJJJGJJJHKFKSTOLOOLOOLOQQKKJJGJJJJHKKKKFJJJJGJJHKKKFKIJJGJJJGJHKFKKFKJJJJJJJHKKFKKFIJJJJJJHKKKKKJJJJJGHKKKKFJJJJJJJHKIKKKJJGJJJGJHKKFKKFJJJJJJGHTOMOOOOOPQKKKFKJJGJJJJHKKFKKKJJJJJJHKFKKFKIJGJJJGJH

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre moonkin_form Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 starfire Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 celestial_alignment Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 starsurge Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse celestial_alignment, draenic_intellect_potion
0:01.087 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
0:02.089 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
0:03.430 starfire Fluffy_Pillow 159056.5/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:04.768 starsurge Fluffy_Pillow 159048.2/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, draenic_intellect_potion
0:05.771 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), starfall, draenic_intellect_potion
0:07.110 starfire Fluffy_Pillow 159051.0/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, lunar_empowerment, starfall, draenic_intellect_potion
0:08.449 starsurge Fluffy_Pillow 159051.0/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, starfall, draenic_intellect_potion
0:09.453 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), starfall, draenic_intellect_potion
0:10.792 starfire Fluffy_Pillow 159051.0/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, draenic_intellect_potion
0:12.133 starsurge Fluffy_Pillow 159056.5/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, starfall, faerie_blessing, draenic_intellect_potion
0:13.140 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing, draenic_intellect_potion
0:14.482 moonfire Fluffy_Pillow 159059.2/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, draenic_intellect_potion
0:15.486 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 16.0/105: 15% eclipse bloodlust, lunar_empowerment, starfall, faerie_blessing, draenic_intellect_potion
0:16.826 starfire Fluffy_Pillow 159053.7/160000: 99% mana | 57.0/105: 54% eclipse bloodlust, starfall, faerie_blessing, draenic_intellect_potion
0:18.501 starfire Fluffy_Pillow 159056.5/160000: 99% mana | 93.6/105: 89% eclipse bloodlust, starfall, faerie_blessing, draenic_intellect_potion
0:20.177 starfire Fluffy_Pillow 159059.2/160000: 99% mana | 104.8/105: 100% eclipse bloodlust, lunar_peak, starfall, faerie_blessing, draenic_intellect_potion
0:21.851 starfire Fluffy_Pillow 159053.7/160000: 99% mana | 87.7/105: 84% eclipse bloodlust, lunar_peak, starfall, faerie_blessing, draenic_intellect_potion
0:23.526 starfire Fluffy_Pillow 159056.5/160000: 99% mana | 46.9/105: 45% eclipse bloodlust, lunar_peak, starfall, faerie_blessing
0:25.199 wrath Fluffy_Pillow 159051.0/160000: 99% mana | -6.6/105: -6% eclipse bloodlust, faerie_blessing
0:26.317 wrath Fluffy_Pillow 158893.7/160000: 99% mana | -42.2/105: -40% eclipse bloodlust, faerie_blessing
0:27.434 wrath Fluffy_Pillow 158891.0/160000: 99% mana | -72.7/105: -69% eclipse bloodlust, faerie_blessing
0:28.553 wrath Fluffy_Pillow 158896.5/160000: 99% mana | -94.3/105: -90% eclipse bloodlust, faerie_blessing
0:29.672 wrath Fluffy_Pillow 158896.5/160000: 99% mana | -104.4/105: -99% eclipse bloodlust, solar_peak, faerie_blessing
0:30.788 wrath Fluffy_Pillow 158888.2/160000: 99% mana | -101.8/105: -97% eclipse bloodlust, solar_peak, faerie_blessing
0:31.907 wrath Fluffy_Pillow 158896.5/160000: 99% mana | -86.7/105: -83% eclipse bloodlust, solar_peak, faerie_blessing
0:33.027 wrath Fluffy_Pillow 158899.2/160000: 99% mana | -61.0/105: -58% eclipse bloodlust, solar_peak, faerie_blessing
0:34.145 sunfire Fluffy_Pillow 158893.7/160000: 99% mana | -27.9/105: -27% eclipse bloodlust, solar_peak, faerie_blessing
0:35.150 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 4.9/105: 5% eclipse bloodlust, faerie_blessing
0:36.824 starsurge Fluffy_Pillow 159053.7/160000: 99% mana | 56.9/105: 54% eclipse bloodlust, faerie_blessing
0:37.828 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 81.5/105: 78% eclipse bloodlust, lunar_empowerment(2), starfall, faerie_blessing
0:39.170 starfire Fluffy_Pillow 159059.2/160000: 99% mana | 101.5/105: 97% eclipse bloodlust, lunar_empowerment, lunar_peak, starfall, faerie_blessing
0:40.508 starsurge Fluffy_Pillow 159048.2/160000: 99% mana | 103.7/105: 99% eclipse bloodlust, lunar_peak, starfall, faerie_blessing
0:41.513 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 93.4/105: 89% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing
0:43.254 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 54.8/105: 52% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
0:44.997 wrath Fluffy_Pillow 159057.4/160000: 99% mana | 0.1/105: 0% eclipse starfall, faerie_blessing
0:46.449 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -46.2/105: -44% eclipse starfall, faerie_blessing
0:47.900 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -83.0/105: -79% eclipse starfall, faerie_blessing
0:49.350 wrath Fluffy_Pillow 158887.5/160000: 99% mana | -102.8/105: -98% eclipse solar_peak, starfall, faerie_blessing
0:50.803 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -101.7/105: -97% eclipse solar_peak, starfall, faerie_blessing
0:52.255 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -79.7/105: -76% eclipse solar_peak, starfall, faerie_blessing
0:53.706 sunfire Fluffy_Pillow 158889.9/160000: 99% mana | -41.5/105: -40% eclipse solar_peak, faerie_blessing
0:54.795 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -6.8/105: -6% eclipse faerie_blessing
0:56.970 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 60.9/105: 58% eclipse faerie_blessing
0:59.145 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 101.2/105: 96% eclipse lunar_peak, faerie_blessing
1:01.320 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 96.1/105: 92% eclipse lunar_peak, faerie_blessing
1:03.496 starsurge Fluffy_Pillow 159054.9/160000: 99% mana | 47.8/105: 46% eclipse lunar_peak, faerie_blessing
1:04.586 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 13.6/105: 13% eclipse lunar_empowerment(2), starfall, faerie_blessing
1:06.037 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -33.6/105: -32% eclipse lunar_empowerment(2), starfall, faerie_blessing
1:07.489 starsurge Fluffy_Pillow 158892.4/160000: 99% mana | -74.0/105: -70% eclipse lunar_empowerment(2), starfall, faerie_blessing
1:08.579 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -94.7/105: -90% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing
1:09.740 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -104.6/105: -100% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(2), starfall, faerie_blessing
1:10.903 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -100.8/105: -96% eclipse lunar_empowerment(2), solar_peak, solar_empowerment, starfall, faerie_blessing
1:12.064 starsurge Fluffy_Pillow 158889.9/160000: 99% mana | -83.7/105: -80% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
1:13.154 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -57.5/105: -55% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(3), starfall, faerie_blessing
1:14.317 sunfire Fluffy_Pillow 158894.9/160000: 99% mana | -22.4/105: -21% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(2), starfall, faerie_blessing
1:15.407 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 13.4/105: 13% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing
1:16.496 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 47.6/105: 45% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing
1:18.237 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 89.3/105: 85% eclipse lunar_empowerment, solar_empowerment(2), starfall, faerie_blessing
1:19.976 starfire Fluffy_Pillow 159047.5/160000: 99% mana | 105.0/105: 100% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
1:22.151 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 81.9/105: 78% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
1:24.327 wrath Fluffy_Pillow 159054.9/160000: 99% mana | 22.0/105: 21% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
1:25.490 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -16.1/105: -15% eclipse solar_empowerment, faerie_blessing
1:26.652 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -52.1/105: -50% eclipse faerie_blessing
1:28.104 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -86.9/105: -83% eclipse faerie_blessing
1:29.557 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -104.0/105: -99% eclipse solar_peak, faerie_blessing
1:31.008 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -99.8/105: -95% eclipse solar_peak, faerie_blessing
1:32.460 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -75.2/105: -72% eclipse solar_peak, faerie_blessing
1:33.911 sunfire Fluffy_Pillow 158889.9/160000: 99% mana | -35.2/105: -34% eclipse solar_peak, faerie_blessing
1:35.001 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse faerie_blessing
1:37.174 starsurge Fluffy_Pillow 159047.5/160000: 99% mana | 66.3/105: 63% eclipse faerie_blessing
1:38.263 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 89.7/105: 85% eclipse lunar_empowerment(2), faerie_blessing
1:40.003 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 105.0/105: 100% eclipse lunar_empowerment, lunar_peak, faerie_blessing
1:41.744 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 89.6/105: 85% eclipse lunar_peak, faerie_blessing
1:42.834 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.1/105: 63% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing
1:44.574 wrath Fluffy_Pillow 159049.9/160000: 99% mana | 14.0/105: 13% eclipse lunar_empowerment, starfall, faerie_blessing
1:46.025 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -33.2/105: -32% eclipse lunar_empowerment, starfall, faerie_blessing
1:47.475 starsurge Fluffy_Pillow 158887.5/160000: 99% mana | -73.7/105: -70% eclipse lunar_empowerment, starfall, faerie_blessing
1:48.564 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -94.5/105: -90% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
1:49.724 wrath Fluffy_Pillow 158887.5/160000: 99% mana | -104.6/105: -100% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing
1:50.884 wrath Fluffy_Pillow 158887.5/160000: 99% mana | -101.0/105: -96% eclipse lunar_empowerment, solar_peak, solar_empowerment, starfall, faerie_blessing
1:52.046 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -84.0/105: -80% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
1:53.498 sunfire Fluffy_Pillow 158892.4/160000: 99% mana | -47.7/105: -45% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
1:54.587 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -13.6/105: -13% eclipse lunar_empowerment, starfall, faerie_blessing
1:56.328 moonfire Fluffy_Pillow 159052.4/160000: 99% mana | 42.5/105: 41% eclipse starfall, faerie_blessing
1:57.418 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 72.3/105: 69% eclipse starfall, faerie_blessing
1:59.593 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 104.1/105: 99% eclipse lunar_peak, starfall, faerie_blessing
2:00.682 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 102.6/105: 98% eclipse lunar_empowerment(2), lunar_peak, faerie_blessing
2:02.422 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 76.0/105: 72% eclipse lunar_empowerment, lunar_peak, faerie_blessing
2:04.161 wrath Fluffy_Pillow 159047.5/160000: 99% mana | 27.4/105: 26% eclipse lunar_peak, faerie_blessing
2:05.612 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -20.1/105: -19% eclipse faerie_blessing
2:07.063 starsurge Fluffy_Pillow 158889.9/160000: 99% mana | -63.4/105: -60% eclipse faerie_blessing
2:08.152 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -87.8/105: -84% eclipse solar_empowerment(3), starfall, faerie_blessing
2:09.315 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -102.6/105: -98% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing
2:10.478 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -103.8/105: -99% eclipse solar_peak, solar_empowerment, starfall
2:11.639 starsurge Fluffy_Pillow 158889.9/160000: 99% mana | -91.4/105: -87% eclipse solar_peak, starfall
2:12.728 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -68.7/105: -65% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing
2:13.889 sunfire Fluffy_Pillow 158889.9/160000: 99% mana | -35.9/105: -34% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing
2:14.979 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -0.7/105: -1% eclipse solar_empowerment(2), starfall, faerie_blessing
2:17.153 starsurge Fluffy_Pillow 159049.9/160000: 99% mana | 65.7/105: 63% eclipse solar_empowerment(2), starfall, faerie_blessing
2:18.241 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 89.4/105: 85% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing
2:19.980 starfire Fluffy_Pillow 159047.5/160000: 99% mana | 105.0/105: 100% eclipse lunar_empowerment, lunar_peak, solar_empowerment(2), starfall, faerie_blessing
2:21.720 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 90.0/105: 86% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
2:23.893 wrath Fluffy_Pillow 159047.5/160000: 99% mana | 35.8/105: 34% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
2:25.054 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -1.8/105: -2% eclipse solar_empowerment, starfall, faerie_blessing
2:26.215 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -39.1/105: -37% eclipse starfall, faerie_blessing
2:27.666 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -78.0/105: -74% eclipse starfall, faerie_blessing
2:29.118 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -101.0/105: -96% eclipse solar_peak, starfall, faerie_blessing
2:30.572 wrath Fluffy_Pillow 158897.4/160000: 99% mana | -103.3/105: -98% eclipse solar_peak, faerie_blessing
2:32.024 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -84.5/105: -80% eclipse solar_peak, faerie_blessing
2:33.476 starsurge Fluffy_Pillow 158892.4/160000: 99% mana | -48.4/105: -46% eclipse solar_peak, faerie_blessing
2:34.565 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -14.3/105: -14% eclipse solar_empowerment(3), faerie_blessing
2:36.740 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 54.6/105: 52% eclipse solar_empowerment(3), faerie_blessing
2:37.830 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 81.5/105: 78% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing
2:38.919 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 99.0/105: 94% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing
2:40.661 starfire Fluffy_Pillow 159054.9/160000: 99% mana | 102.7/105: 98% eclipse lunar_empowerment, lunar_peak, solar_empowerment(3), starfall, faerie_blessing
2:42.401 starsurge Fluffy_Pillow 159049.9/160000: 99% mana | 76.5/105: 73% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
2:43.490 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 48.0/105: 46% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(3), starfall, faerie_blessing
2:45.230 sunfire Fluffy_Pillow 159049.9/160000: 99% mana | -7.6/105: -7% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
2:46.319 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -42.3/105: -40% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
2:47.480 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -73.8/105: -70% eclipse lunar_empowerment, solar_empowerment(2), faerie_blessing
2:48.641 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -95.6/105: -91% eclipse lunar_empowerment, solar_empowerment, faerie_blessing
2:49.803 starsurge Fluffy_Pillow 158892.4/160000: 99% mana | -104.8/105: -100% eclipse lunar_empowerment, solar_peak, faerie_blessing
2:50.892 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -100.9/105: -96% eclipse lunar_empowerment, solar_peak, solar_empowerment(3), starfall, faerie_blessing
2:52.053 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -83.9/105: -80% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing
2:53.215 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -55.8/105: -53% eclipse lunar_empowerment, solar_peak, solar_empowerment, starfall, faerie_blessing
2:54.377 sunfire Fluffy_Pillow 158892.4/160000: 99% mana | -20.4/105: -19% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
2:55.466 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 15.3/105: 15% eclipse lunar_empowerment, starfall, faerie_blessing
2:57.206 starsurge Fluffy_Pillow 159049.9/160000: 99% mana | 67.1/105: 64% eclipse starfall, faerie_blessing
2:58.295 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 90.3/105: 86% eclipse lunar_empowerment(2), starfall, faerie_blessing
3:00.037 potion Fluffy_Pillow 159054.9/160000: 99% mana | 105.0/105: 100% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
3:00.037 celestial_alignment Fluffy_Pillow 159054.9/160000: 99% mana | 105.0/105: 100% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing, draenic_intellect_potion
3:00.037 starfire Fluffy_Pillow 159054.9/160000: 99% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment, lunar_peak, starfall, faerie_blessing, draenic_intellect_potion
3:01.778 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_peak, starfall, faerie_blessing, draenic_intellect_potion
3:02.867 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment(2), lunar_peak, starfall, faerie_blessing, draenic_intellect_potion
3:04.609 starfire Fluffy_Pillow 159054.9/160000: 99% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment, starfall, faerie_blessing, draenic_intellect_potion
3:06.349 starsurge Fluffy_Pillow 159049.9/160000: 99% mana | 105.0/105: 100% eclipse celestial_alignment, starfall, faerie_blessing, draenic_intellect_potion
3:07.440 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing, draenic_intellect_potion
3:09.182 starfire Fluffy_Pillow 159054.9/160000: 99% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment, starfall, faerie_blessing, draenic_intellect_potion
3:10.923 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 105.0/105: 100% eclipse celestial_alignment, starfall, faerie_blessing, draenic_intellect_potion
3:12.014 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing, draenic_intellect_potion
3:13.755 moonfire Fluffy_Pillow 159052.4/160000: 99% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment, starfall, faerie_blessing, draenic_intellect_potion
3:14.845 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse celestial_alignment, lunar_empowerment, starfall, faerie_blessing, draenic_intellect_potion
3:15.935 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 100.5/105: 96% eclipse lunar_empowerment, starfall, faerie_blessing, draenic_intellect_potion
3:17.676 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 70.0/105: 67% eclipse starfall, faerie_blessing, draenic_intellect_potion
3:19.852 wrath Fluffy_Pillow 159054.9/160000: 99% mana | 4.9/105: 5% eclipse starfall, faerie_blessing, draenic_intellect_potion
3:21.304 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -41.8/105: -40% eclipse starfall, faerie_blessing, draenic_intellect_potion
3:22.757 starsurge Fluffy_Pillow 158894.9/160000: 99% mana | -80.0/105: -76% eclipse starfall, faerie_blessing, draenic_intellect_potion
3:23.848 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -98.2/105: -94% eclipse solar_empowerment(3), starfall, faerie_blessing, draenic_intellect_potion
3:25.010 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -105.0/105: -100% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing, draenic_intellect_potion
3:26.171 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -98.0/105: -93% eclipse solar_peak, solar_empowerment, starfall, faerie_blessing
3:27.333 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -78.0/105: -74% eclipse solar_peak, starfall, faerie_blessing
3:28.782 sunfire Fluffy_Pillow 158885.0/160000: 99% mana | -39.2/105: -37% eclipse solar_peak, starfall, faerie_blessing
3:29.871 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -4.3/105: -4% eclipse starfall, faerie_blessing
3:32.044 starfire Fluffy_Pillow 159047.5/160000: 99% mana | 62.9/105: 60% eclipse starfall, faerie_blessing
3:34.218 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 101.8/105: 97% eclipse lunar_peak, faerie_blessing
3:36.392 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 95.1/105: 91% eclipse lunar_peak, faerie_blessing
3:38.564 starsurge Fluffy_Pillow 159045.0/160000: 99% mana | 45.8/105: 44% eclipse lunar_peak, faerie_blessing
3:39.653 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 11.4/105: 11% eclipse lunar_empowerment(2), starfall, faerie_blessing
3:41.105 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -35.7/105: -34% eclipse lunar_empowerment(2), starfall, faerie_blessing
3:42.556 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -75.5/105: -72% eclipse lunar_empowerment(2), starfall, faerie_blessing
3:44.007 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -99.9/105: -95% eclipse lunar_empowerment(2), starfall, faerie_blessing
3:45.457 starsurge Fluffy_Pillow 158887.5/160000: 99% mana | -103.9/105: -99% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
3:46.546 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -92.9/105: -88% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(3), starfall, faerie_blessing
3:47.709 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -69.2/105: -66% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(2), starfall, faerie_blessing
3:48.870 sunfire Fluffy_Pillow 158889.9/160000: 99% mana | -36.5/105: -35% eclipse lunar_empowerment(2), solar_peak, solar_empowerment, starfall, faerie_blessing
3:49.958 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -1.4/105: -1% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing
3:51.699 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 53.4/105: 51% eclipse lunar_empowerment, solar_empowerment, starfall, faerie_blessing
3:53.440 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 92.6/105: 88% eclipse solar_empowerment, starfall, faerie_blessing
3:55.617 starsurge Fluffy_Pillow 159057.4/160000: 99% mana | 103.0/105: 98% eclipse lunar_peak, solar_empowerment, starfall, faerie_blessing
3:56.707 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 90.3/105: 86% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment, starfall, faerie_blessing
3:58.447 moonfire Fluffy_Pillow 159049.9/160000: 99% mana | 49.2/105: 47% eclipse lunar_empowerment, lunar_peak, solar_empowerment, starfall, faerie_blessing
3:59.538 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 15.2/105: 14% eclipse lunar_empowerment, solar_empowerment, starfall, faerie_blessing
4:00.699 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -22.9/105: -22% eclipse lunar_empowerment, starfall, faerie_blessing
4:02.151 starsurge Fluffy_Pillow 158892.4/160000: 99% mana | -65.7/105: -63% eclipse lunar_empowerment, starfall, faerie_blessing
4:03.239 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -89.3/105: -85% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
4:04.400 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -103.1/105: -98% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing
4:05.563 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -103.4/105: -98% eclipse lunar_empowerment, solar_peak, solar_empowerment, starfall, faerie_blessing
4:06.724 starsurge Fluffy_Pillow 158889.9/160000: 99% mana | -90.0/105: -86% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
4:07.813 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -66.6/105: -63% eclipse lunar_empowerment, solar_peak, solar_empowerment(3), starfall, faerie_blessing
4:08.974 sunfire Fluffy_Pillow 158889.9/160000: 99% mana | -33.3/105: -32% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing
4:10.064 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 2.1/105: 2% eclipse lunar_empowerment, solar_empowerment(2), starfall, faerie_blessing
4:11.805 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 56.4/105: 54% eclipse solar_empowerment(2), starfall, faerie_blessing
4:12.896 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 82.9/105: 79% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing
4:14.635 starfire Fluffy_Pillow 159047.5/160000: 99% mana | 104.3/105: 99% eclipse lunar_empowerment, lunar_peak, solar_empowerment(2), starfall, faerie_blessing
4:16.376 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 95.3/105: 91% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
4:17.466 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 75.0/105: 71% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(2), starfall
4:19.207 wrath Fluffy_Pillow 159052.4/160000: 99% mana | 25.9/105: 25% eclipse lunar_empowerment, lunar_peak, solar_empowerment(2), starfall, faerie_blessing
4:20.369 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -12.1/105: -12% eclipse lunar_empowerment, solar_empowerment, starfall, faerie_blessing
4:21.529 wrath Fluffy_Pillow 158887.5/160000: 99% mana | -48.5/105: -46% eclipse lunar_empowerment, starfall, faerie_blessing
4:22.981 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -84.6/105: -81% eclipse lunar_empowerment, starfall, faerie_blessing
4:24.432 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -103.3/105: -98% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
4:25.884 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -101.0/105: -96% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
4:27.336 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -78.0/105: -74% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
4:28.788 sunfire Fluffy_Pillow 158892.4/160000: 99% mana | -39.0/105: -37% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
4:29.876 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -4.1/105: -4% eclipse lunar_empowerment, faerie_blessing
4:31.618 starfire Fluffy_Pillow 159054.9/160000: 99% mana | 51.1/105: 49% eclipse faerie_blessing
4:33.792 starsurge Fluffy_Pillow 159049.9/160000: 99% mana | 97.5/105: 93% eclipse faerie_blessing
4:34.880 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing
4:36.621 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 91.7/105: 87% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
4:38.362 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 51.7/105: 49% eclipse lunar_peak, starfall, faerie_blessing
4:39.453 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 18.0/105: 17% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing
4:40.542 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -17.8/105: -17% eclipse lunar_empowerment(2), starfall, faerie_blessing
4:41.994 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -61.6/105: -59% eclipse lunar_empowerment(2), starfall, faerie_blessing
4:43.446 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -92.7/105: -88% eclipse lunar_empowerment(2), starfall, faerie_blessing
4:44.897 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -104.9/105: -100% eclipse lunar_empowerment(2), solar_peak, faerie_blessing
4:46.349 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -95.7/105: -91% eclipse lunar_empowerment(2), solar_peak, faerie_blessing
4:47.802 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -66.9/105: -64% eclipse lunar_empowerment(2), solar_peak, faerie_blessing
4:49.254 sunfire Fluffy_Pillow 158892.4/160000: 99% mana | -24.4/105: -23% eclipse lunar_empowerment(2), solar_peak, faerie_blessing
4:50.344 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 11.3/105: 11% eclipse lunar_empowerment(2), faerie_blessing
4:52.085 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 64.0/105: 61% eclipse lunar_empowerment, faerie_blessing
4:53.825 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 97.9/105: 93% eclipse faerie_blessing
4:56.000 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 99.9/105: 95% eclipse lunar_peak, faerie_blessing
4:58.174 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 57.0/105: 54% eclipse lunar_peak, faerie_blessing
5:00.347 wrath Fluffy_Pillow 159047.5/160000: 99% mana | -11.4/105: -11% eclipse faerie_blessing
5:01.801 wrath Fluffy_Pillow 158897.4/160000: 99% mana | -56.3/105: -54% eclipse faerie_blessing
5:03.251 wrath Fluffy_Pillow 158887.5/160000: 99% mana | -89.5/105: -85% eclipse faerie_blessing
5:04.703 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -104.5/105: -100% eclipse solar_peak, faerie_blessing
5:06.152 wrath Fluffy_Pillow 158885.0/160000: 99% mana | -98.2/105: -94% eclipse solar_peak, faerie_blessing
5:07.604 starsurge Fluffy_Pillow 158892.4/160000: 99% mana | -71.8/105: -68% eclipse solar_peak, faerie_blessing
5:08.692 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | -41.9/105: -40% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing
5:09.781 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -7.2/105: -7% eclipse solar_empowerment(3), starfall, faerie_blessing
5:11.954 starfire Fluffy_Pillow 159047.5/160000: 99% mana | 60.5/105: 58% eclipse solar_empowerment(3), starfall, faerie_blessing
5:14.128 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 101.1/105: 96% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
5:16.303 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 96.3/105: 92% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
5:18.476 starsurge Fluffy_Pillow 159047.5/160000: 99% mana | 48.4/105: 46% eclipse lunar_peak, solar_empowerment(3), faerie_blessing
5:19.564 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 14.3/105: 14% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing
5:20.725 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -23.7/105: -23% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing
5:21.886 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -58.6/105: -56% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing
5:23.048 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -85.9/105: -82% eclipse lunar_empowerment(2), starfall, faerie_blessing
5:24.500 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -103.7/105: -99% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
5:25.952 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -100.3/105: -96% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
5:27.405 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -76.4/105: -73% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
5:28.856 sunfire Fluffy_Pillow 158889.9/160000: 99% mana | -36.9/105: -35% eclipse lunar_empowerment(2), solar_peak, faerie_blessing
5:29.946 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -1.8/105: -2% eclipse lunar_empowerment(2), faerie_blessing
5:31.687 moonfire Fluffy_Pillow 159052.4/160000: 99% mana | 53.1/105: 51% eclipse lunar_empowerment, faerie_blessing
5:32.776 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 80.4/105: 77% eclipse lunar_empowerment, faerie_blessing
5:34.518 starfire Fluffy_Pillow 159054.9/160000: 99% mana | 103.8/105: 99% eclipse lunar_peak, faerie_blessing
5:36.692 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 90.5/105: 86% eclipse lunar_peak, faerie_blessing
5:38.866 wrath Fluffy_Pillow 159049.9/160000: 99% mana | 36.6/105: 35% eclipse lunar_peak, faerie_blessing
5:40.318 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -10.5/105: -10% eclipse faerie_blessing
5:41.769 starsurge Fluffy_Pillow 158889.9/160000: 99% mana | -55.4/105: -53% eclipse faerie_blessing
5:42.856 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -82.1/105: -78% eclipse solar_empowerment(3), faerie_blessing
5:44.018 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -100.0/105: -95% eclipse solar_peak, solar_empowerment(2), faerie_blessing
5:45.179 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -104.8/105: -100% eclipse solar_peak, solar_empowerment, faerie_blessing
5:46.342 starsurge Fluffy_Pillow 158894.9/160000: 99% mana | -95.8/105: -91% eclipse solar_peak, faerie_blessing
5:47.431 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -75.8/105: -72% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing
5:48.592 sunfire Fluffy_Pillow 158889.9/160000: 99% mana | -44.9/105: -43% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing
5:49.681 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -10.5/105: -10% eclipse solar_empowerment(2), starfall, faerie_blessing
5:51.856 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 57.8/105: 55% eclipse solar_empowerment(2), starfall, faerie_blessing
5:54.031 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 100.2/105: 95% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
5:55.120 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(2), starfall, faerie_blessing
5:56.861 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 87.6/105: 83% eclipse lunar_empowerment, lunar_peak, solar_empowerment(2), starfall, faerie_blessing
5:58.602 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 44.6/105: 43% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
5:59.692 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 10.1/105: 10% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing
6:00.853 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -27.8/105: -26% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing
6:02.015 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -62.1/105: -59% eclipse lunar_empowerment(2), starfall, faerie_blessing
6:03.466 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -93.0/105: -89% eclipse lunar_empowerment(2), starfall, faerie_blessing
6:04.919 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -105.0/105: -100% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
6:06.372 wrath Fluffy_Pillow 158894.9/160000: 99% mana | -95.4/105: -91% eclipse lunar_empowerment(2), solar_peak, faerie_blessing
6:07.823 starsurge Fluffy_Pillow 158889.9/160000: 99% mana | -66.3/105: -63% eclipse lunar_empowerment(2), solar_peak, faerie_blessing
6:08.913 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | -35.2/105: -33% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(3), faerie_blessing
6:10.001 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse lunar_empowerment(2), solar_empowerment(3), faerie_blessing
6:10.001 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse celestial_alignment, lunar_empowerment(2), solar_empowerment(3), faerie_blessing
6:11.742 moonfire Fluffy_Pillow 159052.4/160000: 99% mana | 0.0/105: 0% eclipse celestial_alignment, lunar_empowerment, solar_empowerment(3), faerie_blessing
6:12.831 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse celestial_alignment, lunar_empowerment, solar_empowerment(3), faerie_blessing
6:14.572 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 0.0/105: 0% eclipse celestial_alignment, solar_empowerment(3), faerie_blessing
6:16.746 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 0.0/105: 0% eclipse celestial_alignment, solar_empowerment(3), faerie_blessing
6:18.919 starfire Fluffy_Pillow 159047.5/160000: 99% mana | 0.0/105: 0% eclipse celestial_alignment, solar_empowerment(3), faerie_blessing
6:21.093 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 0.0/105: 0% eclipse celestial_alignment, solar_empowerment(3), faerie_blessing
6:23.267 wrath Fluffy_Pillow 159049.9/160000: 99% mana | 0.0/105: 0% eclipse celestial_alignment, solar_empowerment(3), faerie_blessing
6:24.429 moonfire Fluffy_Pillow 158892.4/160000: 99% mana | 0.0/105: 0% eclipse celestial_alignment, solar_empowerment(2), faerie_blessing
6:25.518 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 17.0/105: 16% eclipse solar_empowerment(2), faerie_blessing
6:27.692 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 78.6/105: 75% eclipse solar_empowerment(2), faerie_blessing
6:29.867 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 104.9/105: 100% eclipse lunar_peak, solar_empowerment(2), faerie_blessing
6:32.043 starsurge Fluffy_Pillow 159054.9/160000: 99% mana | 84.1/105: 80% eclipse lunar_peak, solar_empowerment(2), faerie_blessing
6:33.133 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 58.1/105: 55% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(2), faerie_blessing
6:34.873 wrath Fluffy_Pillow 159049.9/160000: 99% mana | 4.2/105: 4% eclipse lunar_empowerment, solar_empowerment(2), faerie_blessing
6:36.033 wrath Fluffy_Pillow 158887.5/160000: 99% mana | -33.5/105: -32% eclipse lunar_empowerment, solar_empowerment, faerie_blessing
6:37.194 starsurge Fluffy_Pillow 158889.9/160000: 99% mana | -66.8/105: -64% eclipse lunar_empowerment, faerie_blessing
6:38.284 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -90.1/105: -86% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
6:39.445 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -103.4/105: -98% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing
6:40.606 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -103.1/105: -98% eclipse lunar_empowerment, solar_peak, solar_empowerment, starfall, faerie_blessing
6:41.767 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -89.2/105: -85% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
6:43.218 sunfire Fluffy_Pillow 158889.9/160000: 99% mana | -55.8/105: -53% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
6:44.307 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -22.7/105: -22% eclipse lunar_empowerment, starfall, faerie_blessing
6:46.047 starfire Fluffy_Pillow 159049.9/160000: 99% mana | 33.9/105: 32% eclipse starfall, faerie_blessing
6:48.222 starsurge Fluffy_Pillow 159052.4/160000: 99% mana | 89.0/105: 85% eclipse faerie_blessing
6:49.313 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 102.6/105: 98% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing
6:51.054 starfire Fluffy_Pillow 159052.4/160000: 99% mana | 99.3/105: 95% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
6:52.796 starfire Fluffy_Pillow 159054.9/160000: 99% mana | 67.0/105: 64% eclipse lunar_peak, starfall, faerie_blessing
6:54.971 wrath Fluffy_Pillow 159052.4/160000: 99% mana | 1.0/105: 1% eclipse starfall, faerie_blessing
6:56.423 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -45.4/105: -43% eclipse starfall, faerie_blessing
6:57.875 wrath Fluffy_Pillow 158892.4/160000: 99% mana | -82.5/105: -79% eclipse starfall, faerie_blessing
6:59.329 wrath Fluffy_Pillow 158897.4/160000: 99% mana | -102.7/105: -98% eclipse solar_peak, faerie_blessing
7:00.780 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -101.9/105: -97% eclipse solar_peak, faerie_blessing
7:02.231 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -80.2/105: -76% eclipse solar_peak, faerie_blessing
7:03.684 sunfire Fluffy_Pillow 158894.9/160000: 99% mana | -42.2/105: -40% eclipse solar_peak, faerie_blessing
7:04.775 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -7.4/105: -7% eclipse faerie_blessing
7:06.949 starsurge Fluffy_Pillow 159049.9/160000: 99% mana | 60.3/105: 57% eclipse faerie_blessing
7:08.039 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 85.7/105: 82% eclipse lunar_empowerment(2), starfall, faerie_blessing
7:09.781 starfire Fluffy_Pillow 159054.9/160000: 99% mana | 104.8/105: 100% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
7:11.523 starsurge Fluffy_Pillow 159054.9/160000: 99% mana | 93.2/105: 89% eclipse lunar_peak, starfall, faerie_blessing
7:12.614 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 71.5/105: 68% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing
7:14.355 moonfire Fluffy_Pillow 159052.4/160000: 99% mana | 21.1/105: 20% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
7:15.445 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -14.6/105: -14% eclipse lunar_empowerment, starfall, faerie_blessing
7:16.896 starsurge Fluffy_Pillow 158889.9/160000: 99% mana | -58.9/105: -56% eclipse lunar_empowerment, starfall, faerie_blessing
7:17.985 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -84.7/105: -81% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
7:19.145 wrath Fluffy_Pillow 158887.5/160000: 99% mana | -101.2/105: -96% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing
7:20.306 wrath Fluffy_Pillow 158889.9/160000: 99% mana | -104.5/105: -100% eclipse lunar_empowerment, solar_peak, solar_empowerment, starfall, faerie_blessing
7:21.467 starsurge Fluffy_Pillow 158889.9/160000: 99% mana | -94.0/105: -90% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
7:22.557 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -72.9/105: -69% eclipse lunar_empowerment, solar_peak, solar_empowerment(3), starfall, faerie_blessing
7:23.717 sunfire Fluffy_Pillow 158887.5/160000: 99% mana | -41.2/105: -39% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 660 629 629
Agility 1350 1286 1286
Stamina 8241 7492 7492
Intellect 6727 6143 5903 (4814)
Spirit 781 781 781
Health 494460 449520 0
Mana 160000 160000 0
Eclipse 105 105 0
Spell Power 10226 8712 2569
Crit 17.30% 12.30% 693
Haste 38.19% 31.61% 2845
Multistrike 12.95% 7.95% 525
Damage / Heal Versatility 3.00% 0.00% 0
ManaReg per Second 2484 640 0
Attack Power 1485 1286 0
Mastery 76.15% 60.05% 1762
Armor 4158 1386 1386
Run Speed 0 0 173

Gear

Source Slot Average Item Level: 736.00
Local Head Oathclaw Helm
ilevel: 735, stats: { 190 Armor, +444 AgiInt, +667 Sta, +359 Mastery, +232 Crit }, gems: { +75 Haste }
Local Neck Locket of Unholy Reconstitution
ilevel: 740, stats: { +262 Int, +393 Sta, +249 Spi, +100 Mult }, enchant: { +75 Haste }
Local Shoulders Oathclaw Mantle
ilevel: 710, stats: { 152 Armor, +264 AgiInt, +396 Sta, +228 Mastery, +123 Haste }
Local Chest Oathclaw Vestment
ilevel: 710, stats: { 203 Armor, +352 AgiInt, +528 Sta, +294 Haste, +174 Mastery }, gems: { +75 Haste }
Local Waist Belt of Misconceived Loyalty
ilevel: 735, stats: { 131 Armor, +333 AgiInt, +500 Sta, +288 Crit, +155 Mastery }
Local Legs Oathclaw Leggings
ilevel: 725, stats: { 193 Armor, +405 AgiInt, +607 Sta, +316 Mult, +223 Mastery }
Local Feet Oppressor's Merciless Treads
ilevel: 740, stats: { 165 Armor, +349 AgiInt, +524 Sta, +292 Haste, +173 Crit }
Local Wrists Gorebound Wristguards
ilevel: 736, stats: { 103 Armor, +252 AgiInt, +379 Sta, +204 Mastery, +132 Haste }
Local Hands Felfinger Runegloves
ilevel: 745, stats: { 155 Armor, +366 AgiInt, +548 Sta, +348 Haste, +139 Mastery }, gems: { +75 Haste }
Local Finger1 Ring of Foul Temptation
ilevel: 735, stats: { +250 Int, +375 Sta, +223 Spi, +109 Mult }, enchant: { +50 Haste }
Local Finger2 Etheralus, the Eternal Reward
ilevel: 792, stats: { +425 Int, +637 Sta, +312 Spi, +235 Haste }, enchant: { +50 Haste }
Local Trinket1 Seed of Creation
ilevel: 725, stats: { +173 RunSpeed }
Local Trinket2 Demonic Phylactery
ilevel: 735, stats: { +413 Haste, +413 Int }
Local Back Drape of Beckoned Souls
ilevel: 735, stats: { 94 Armor, +250 Int, +375 Sta, +226 Spi, +107 Haste }, enchant: { +100 Haste }
Local Main Hand Edict of Argus
ilevel: 736, weapon: { 934 - 1403, 2.9 }, stats: { +449 Int, +673 Sta, +401 Haste, +196 Mastery, +2569 SP }, enchant: mark_of_shadowmoon

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Balance Druid) Mass Entanglement Typhoon
60 Soul of the Forest Incarnation: Chosen of Elune Force of Nature
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil
100 Euphoria Stellar Flare Balance of Power

Profile

druid="Töpszfix"
origin="https://eu.api.battle.net/wow/character/arathor/Töpszfix/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hellfire/117/120912245-avatar.jpg"
level=100
race=worgen
role=spell
position=back
professions=leatherworking=700/skinning=715
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!1010200
glyphs=moonwarding/rebirth/entangling_energy/chameleon/stars/untamed_stars
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_sushi
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/incarnation
actions.precombat+=/starfire

# Executed every time the actor is available.

actions=force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
actions+=/call_action_list,name=cooldowns,if=cooldown.celestial_alignment.up&(eclipse_energy>=0|target.time_to_die<=30+gcd)
actions+=/call_action_list,name=ca_aoe,if=buff.celestial_alignment.up&spell_targets.starfall_pulse>1&!t18_class_trinket
actions+=/call_action_list,name=ca,if=buff.celestial_alignment.up&(spell_targets.starfall_pulse=1|t18_class_trinket)
actions+=/call_action_list,name=aoe_t18_trinket,if=buff.celestial_alignment.down&spell_targets.starfall.pulse>1&t18_class_trinket
actions+=/call_action_list,name=aoe,if=spell_targets.starfall_pulse>1&buff.celestial_alignment.down&!t18_class_trinket
actions+=/call_action_list,name=single_target,if=spell_targets.starfall_pulse=1&buff.celestial_alignment.down

actions.single_target=starsurge,if=charges=3
actions.single_target+=/starsurge,if=buff.lunar_empowerment.down&eclipse_energy>40
actions.single_target+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
actions.single_target+=/sunfire,if=!talent.balance_of_power.enabled&((remains<solar_max&eclipse_dir.solar)|(buff.solar_peak.up&buff.solar_peak.remains<action.wrath.cast_time))
actions.single_target+=/sunfire,if=talent.balance_of_power.enabled&(remains<lunar_max+10|remains<action.wrath.cast_time)
actions.single_target+=/stellar_flare,if=remains<7
actions.single_target+=/moonfire,if=!talent.euphoria.enabled&!talent.balance_of_power.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+20))
actions.single_target+=/moonfire,if=talent.euphoria.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+10))
actions.single_target+=/moonfire,if=talent.balance_of_power.enabled&(remains<solar_max+10|remains<action.starfire.cast_time)
actions.single_target+=/wrath,if=(eclipse_energy<0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.single_target+=/starfire

actions.aoe=sunfire,cycle_targets=1,if=remains<8
actions.aoe+=/starfall,if=spell_targets.starfall_pulse>2&buff.starfall.remains<3
actions.aoe+=/starfall,if=@eclipse_energy<20&eclipse_dir.lunar&buff.starfall.remains<3&talent.euphoria.enabled
actions.aoe+=/starfall,if=@eclipse_energy<10&eclipse_dir.lunar&buff.starfall.remains<3&!talent.euphoria.enabled
actions.aoe+=/moonfire,cycle_targets=1,if=remains<12
actions.aoe+=/stellar_flare,cycle_targets=1,if=remains<7
actions.aoe+=/starsurge,if=(buff.lunar_empowerment.down&eclipse_energy>40&charges>1)|charges=3
actions.aoe+=/starsurge,if=(buff.solar_empowerment.down&eclipse_energy<-40&charges>1)|charges=3
actions.aoe+=/wrath,if=(eclipse_energy<=0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.aoe+=/starfire

actions.ca=starsurge,if=(buff.lunar_empowerment.down&eclipse_energy>=0)|(buff.solar_empowerment.down&eclipse_energy<0)
actions.ca+=/moonfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
actions.ca+=/sunfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
actions.ca+=/starfire,if=eclipse_energy>=0&buff.celestial_alignment.remains>cast_time
actions.ca+=/wrath,if=buff.celestial_alignment.remains>cast_time
actions.ca+=/moonfire,cycle_targets=1
actions.ca+=/sunfire,cycle_targets=1

actions.ca_aoe=starfall,if=buff.starfall.remains<3
actions.ca_aoe+=/moonfire,cycle_targets=1,if=!dot.moonfire.ticking|!dot.sunfire.ticking
actions.ca_aoe+=/sunfire,cycle_targets=1,if=!dot.moonfire.ticking|!dot.sunfire.ticking
actions.ca_aoe+=/starsurge,if=buff.lunar_empowerment.down&eclipse_energy>=0&charges>1
actions.ca_aoe+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<0&charges>1
actions.ca_aoe+=/starfire,if=eclipse_energy>=0&buff.celestial_alignment.remains>cast_time
actions.ca_aoe+=/wrath,if=buff.celestial_alignment.remains>cast_time
actions.ca_aoe+=/moonfire,cycle_targets=1
actions.ca_aoe+=/sunfire,cycle_targets=1

actions.aoe_t18_trinket=starsurge,if=charges=3
actions.aoe_t18_trinket+=/sunfire,cycle_targets=1,if=remains<8
actions.aoe_t18_trinket+=/moonfire,cycle_targets=1,if=remains<12
actions.aoe_t18_trinket+=/starsurge,if=eclipse_energy>40&buff.lunar_empowerment.down
actions.aoe_t18_trinket+=/starsurge,if=eclipse_energy<-40&buff.solar_empowerment.down
actions.aoe_t18_trinket+=/wrath,if=(eclipse_energy<0&action.starfire.cast_time<eclipse_change)|(eclipse_energy>0&cast_time>eclipse_change)
actions.aoe_t18_trinket+=/starfire

actions.cooldowns=incarnation
actions.cooldowns+=/potion,name=draenic_intellect
actions.cooldowns+=/celestial_alignment

head=oathclaw_helm,id=124261,bonus_id=565/567,upgrade=2,gems=75haste
neck=locket_of_unholy_reconstitution,id=124215,bonus_id=567,upgrade=2,enchant=75haste
shoulders=oathclaw_mantle,id=124272,bonus_id=566
back=drape_of_beckoned_souls,id=124141,bonus_id=567,upgrade=2,enchant=gift_of_haste
chest=oathclaw_vestment,id=124246,bonus_id=564/566,gems=75haste
wrists=gorebound_wristguards,id=124278,bonus_id=562/567,upgrade=2
hands=felfinger_runegloves,id=124254,bonus_id=565/567,upgrade=2,gems=75haste
waist=belt_of_misconceived_loyalty,id=124275,bonus_id=567,upgrade=2
legs=oathclaw_leggings,id=124267,bonus_id=567
feet=oppressors_merciless_treads,id=124251,bonus_id=567,upgrade=2
finger1=ring_of_foul_temptation,id=124194,bonus_id=567,upgrade=2,enchant=50haste
finger2=etheralus_the_eternal_reward,id=124638,bonus_id=640/649,enchant=50haste
trinket1=seed_of_creation,id=124514,bonus_id=42/566,upgrade=1
trinket2=demonic_phylactery,id=124233,bonus_id=567,upgrade=2
main_hand=edict_of_argus,id=124382,bonus_id=561/566,upgrade=2,enchant=mark_of_shadowmoon

# Gear Summary
# gear_ilvl=735.60
# gear_stamina=6602
# gear_intellect=4814
# gear_spell_power=2569
# gear_crit_rating=693
# gear_haste_rating=2845
# gear_mastery_rating=1678
# gear_multistrike_rating=525
# gear_speed_rating=173
# gear_armor=1386
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1

Thornpaw

Thornpaw : 44677 dps, 44677 dps to main target, 12778 dtps, 21828 hps (21828 aps), 67.0k TMI, 67.8k ETMI

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR APS APS Error APS Range APR
44677.2 44677.2 9.2 / 0.021% 2898.8 / 6.5% 3669.5 21828.2 23.40 / 0.11% 3706 / 17.0% 0.0
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
12778.1 8.87 / 0.07% 2811 / 22.0%       67.0k 12 / 0.02% 63.6k 71.4k 3.9k / 5.9%       29.8% 18.1% 44.9% 9.5       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
11.0 11.0 Rage 0.00% 72.6 100.0% 100%
Origin https://eu.api.battle.net/wow/character/arathor/Thornpaw/advanced
Talents
  • 15: Wild Charge
  • 30: Cenarion Ward
  • 45: Typhoon
  • 60: Soul of the Forest (Guardian Druid)
  • 75: Ursol's Vortex
  • 90: Dream of Cenarius (Guardian Druid)
  • 100: Pulverize (Guardian Druid)
  • Talent Calculator
Glyphs
  • Glyph of Stampeding Roar
  • Glyph of Survival Instincts
  • Glyph of Faerie Fire
  • Glyph of Travel
  • Glyph of Grace
  • Glyph of Aquatic Form
Professions
  • leatherworking: 700
  • engineering: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% M-Count M-Hit M-Crit M-Crit% Up%
Thornpaw 44677
bear_melee 4791 10.7% 223.3 2.01sec 9649 4797 Direct 223.3 6747 13494 8561 26.9% 0.0% 7.5% 94.6 2024 4048 26.9%  

Stats details: bear_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.32 223.32 0.00 0.00 2.0116 0.0000 2154784.34 3387703.11 36.39 4796.69 4796.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 23.51 26.86% 4140.66 3814 5855 4141.53 3814 4977 97344 149602 34.93
multistrike_crit (blocked) 1.89 0.85% 2896.03 2670 4099 2451.05 0 4099 5480 12032 46.07
multistrike 64.02 73.14% 2070.65 1907 2928 2071.06 1936 2263 132569 203738 34.93
multistrike (blocked) 5.18 2.32% 1449.50 1335 2049 1439.80 0 2049 7508 16485 54.09
hit 151.03 67.63% 6902.10 6356 9759 6903.61 6656 7141 1042443 1602070 34.93
hit (blocked) 12.23 5.48% 4831.50 4449 6831 4832.08 0 6267 59106 129767 54.45
crit 55.55 24.87% 13805.01 12713 19517 13807.94 12831 15578 766828 1178494 34.93
crit (blocked) 4.50 2.02% 9660.91 8899 13662 9539.94 0 13662 43506 95516 53.77
 
 

Action details: bear_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Lacerate 10979 24.6% 178.8 2.53sec 27634 22593 Direct 178.8 13762 27517 17461 26.9% 0.0% 7.5% 75.7 4128 8258 26.9%  
Periodic 381.8 2605 5208 3305 26.9% 0.0% 0.0% 161.7 782 1563 26.9% 84.9%

Stats details: lacerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 178.80 178.80 381.85 381.85 1.2231 1.0000 4940805.81 5021662.65 1.61 8227.33 22592.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 18.82 26.88% 8447.98 7789 12047 8448.17 7789 10316 159005 159005 0.00
multistrike_crit (blocked) 1.53 0.86% 5927.11 5452 8433 4618.71 0 8433 9095 12993 23.39
multistrike 51.20 73.12% 4222.77 3894 6024 4223.26 3922 4690 216199 216199 0.00
multistrike (blocked) 4.15 2.32% 2955.03 2726 4216 2900.00 0 4216 12262 17517 29.44
hit 120.92 67.63% 14078.13 12981 20078 14079.75 13486 14728 1702347 1702347 0.00
hit (blocked) 9.79 5.48% 9852.88 9087 14055 9852.49 0 14055 96464 137806 30.00
crit 44.49 24.88% 28148.47 25963 40157 28151.01 26161 31110 1252286 1252286 0.00
crit (blocked) 3.59 2.01% 19707.06 18174 28110 19064.24 0 28110 70845 101207 29.02
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 43.5 26.89% 1562.68 658 3052 1562.14 1109 2015 67932 67932 0.00
multistrike 118.2 73.11% 781.65 329 1526 781.32 648 908 92381 92381 0.00
hit 279.2 73.11% 2605.12 1096 5086 2604.09 2437 2779 727274 727274 0.00
crit 102.7 26.89% 5207.78 2192 10172 5205.94 4345 6054 534716 534716 0.00
 
 

Action details: lacerate

Static Values
  • id:33745
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.pulverize.enabled&buff.pulverize.remains<=(3-dot.lacerate.stack)*gcd&buff.berserk.down
Spelldata
  • id:33745
  • name:Lacerate
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Lacerates the enemy target, dealing {$s2=1} bleed damage and an additional $o1 over {$d=15 seconds}. Stacks up to {$u=3} times. Generates ${$m3/10} Rage and has a 25% chance to reset the cooldown on Mangle.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.209000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.102000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mangle 12219 27.3% 112.8 3.95sec 48647 40341 Direct 112.8 31521 63030 43159 36.9% 0.0% 7.5% 47.8 9456 18911 37.0%  

Stats details: mangle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.84 112.84 0.00 0.00 1.2059 0.0000 5489282.96 8629951.86 36.39 40341.31 40341.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.37 37.01% 19339.32 17543 26934 19347.39 17543 24019 316643 486631 34.93
multistrike_crit (blocked) 1.31 1.16% 13545.87 12280 18854 9862.04 0 18854 17717 38897 39.62
multistrike 27.87 62.99% 9673.73 8772 13467 9677.96 8799 11205 269591 414319 34.93
multistrike (blocked) 2.25 2.00% 6764.28 6140 9427 6033.03 0 9427 15249 33480 48.58
hit 65.84 58.35% 32244.25 29239 44890 32257.92 30364 35007 2123072 3262826 34.93
hit (blocked) 5.32 4.71% 22573.24 20467 31423 22468.88 0 31423 120052 263572 54.17
crit 38.55 34.16% 64487.74 58478 89780 64514.00 58995 75196 2485751 3820206 34.93
crit (blocked) 3.13 2.78% 45088.12 40935 62846 42925.11 0 62846 141208 310020 51.82
 
 

Action details: mangle

Static Values
  • id:33917
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33917
  • name:Mangle
  • school:physical
  • tooltip:
  • description:Mangle the target for $sw2 Physical damage, {$?s48484=false}[reducing the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}, and][] generating ${$m3/10} Rage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.00
 
Maul 2654 5.9% 82.5 5.40sec 14477 0 Direct 82.5 10128 20257 12843 26.8% 0.0% 7.5% 34.9 3038 6078 26.9%  

Stats details: maul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.45 82.45 0.00 0.00 0.0000 0.0000 1193637.56 1876650.80 36.40 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.71 26.94% 6217.36 5721 8783 6218.05 0 8783 54127 83185 34.92
multistrike_crit (blocked) 0.70 0.85% 4353.99 4004 6148 2187.47 0 6148 3064 6728 27.35
multistrike 23.61 73.06% 3108.52 2860 4391 3109.76 2865 3855 73397 112799 34.93
multistrike (blocked) 1.92 2.33% 2175.28 2002 3074 1851.17 0 3074 4176 9167 46.36
hit 55.83 67.71% 10361.53 9534 14638 10364.59 9660 11171 578492 889050 34.93
hit (blocked) 4.53 5.49% 7252.54 6674 10247 7172.91 0 10247 32823 72063 53.85
crit 20.44 24.79% 20721.19 19069 29276 20729.51 19069 24662 423523 650888 34.93
crit (blocked) 1.65 2.01% 14524.26 13348 20493 11705.66 0 20493 24036 52770 43.91
 
 

Action details: maul

Static Values
  • id:6807
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.tooth_and_claw.react&incoming_damage_1s
Spelldata
  • id:6807
  • name:Maul
  • school:physical
  • tooltip:
  • description:Maul the target for $sw2 Physical damage{$?s54811=false}[, and an additional $168883sw2 damage to a nearby target][].{$?s48484=false}[ Reduces target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] Deals {$s3=20}% additional damage against bleeding targets.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.25
 
Pulverize 3277 7.3% 36.4 12.42sec 40467 33067 Direct 36.4 28298 56601 35902 26.9% 0.0% 7.5% 15.4 8486 16974 26.9%  

Stats details: pulverize

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.44 36.44 0.00 0.00 1.2238 0.0000 1474443.06 2318014.05 36.39 33066.68 33066.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.84 26.87% 17370.51 16018 24592 16994.37 0 24592 66644 102422 34.16
multistrike_crit (blocked) 0.31 0.86% 12150.66 11213 17214 3248.71 0 17214 3827 8401 14.56
multistrike 10.44 73.13% 8682.89 8009 12296 8684.26 8009 12184 90656 139324 34.93
multistrike (blocked) 0.85 2.35% 6084.00 5606 8607 3481.39 0 8607 5202 11420 31.17
hit 24.66 67.67% 28946.71 26697 40987 28955.25 26821 31411 713712 1096862 34.93
hit (blocked) 1.99 5.46% 20266.59 18688 28691 17608.52 0 28691 40345 88576 47.25
crit 9.06 24.86% 57908.14 53393 81973 57918.23 0 81973 524439 805980 34.93
crit (blocked) 0.73 2.01% 40439.17 37375 57381 21026.65 0 57381 29619 65029 28.30
 
 

Action details: pulverize

Static Values
  • id:80313
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pulverize.remains<=3.6
Spelldata
  • id:80313
  • name:Pulverize
  • school:physical
  • tooltip:
  • description:A devastating blow that consumes 3 stacks of your Lacerate on the target to deal $sw1 Physical damage, and reduce damage taken by {$158792s1=15}% for {$158792d=12 seconds}.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.20
 
Stalwart Guardian (_reflect) 2411 5.4% 265.0 1.68sec 4092 0 Direct 265.0 2861 5722 3630 26.9% 0.0% 7.5% 112.3 858 1717 26.9%  

Stats details: stalwart_guardian_reflect

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 265.03 265.03 0.00 0.00 0.0000 0.0000 1084472.40 1084472.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.97 26.92% 1716.53 1574 2435 1717.29 1574 2006 48020 48020 0.00
multistrike_crit (blocked) 2.26 0.85% 1716.24 1574 2435 1532.75 0 2435 3874 3874 0.00
multistrike 75.93 73.08% 858.36 787 1218 858.75 797 942 65173 65173 0.00
multistrike (blocked) 6.15 2.32% 857.58 787 1218 855.47 0 1218 5273 5273 0.00
hit 179.27 67.64% 2861.06 2624 4058 2862.39 2749 2980 512897 512897 0.00
hit (blocked) 14.52 5.48% 2861.73 2624 4058 2863.08 2624 3659 41557 41557 0.00
crit 65.89 24.86% 5722.34 5247 8117 5724.99 5314 6315 377045 377045 0.00
crit (blocked) 5.35 2.02% 5723.91 5247 8117 5691.06 0 8117 30635 30635 0.00
 
 

Action details: stalwart_guardian_reflect

Static Values
  • id:185321
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185321
  • name:Stalwart Guardian
  • school:nature
  • tooltip:
  • description:{$@spelldesc184878=All damage received is reduced by ${$AP*$m1/100} (increased by Attack Power). This effect cannot absorb more than {$s2=90}% of an attack.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5214.44
  • base_dd_max:1.00
 
Thrash (_bear) 4177 9.4% 28.0 16.16sec 67133 55124 Direct 28.0 7317 14630 9285 26.9% 0.0% 7.5% 11.9 2194 4397 26.9%  
Periodic 218.4 5079 10155 6444 26.9% 0.0% 0.0% 92.5 1524 3047 26.9% 97.1%

Stats details: thrash_bear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.00 28.00 218.44 218.44 1.2179 2.0000 1879667.20 1886420.62 0.36 3990.94 55123.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.95 26.90% 4497.49 4141 6404 4266.97 0 6404 13285 13285 0.00
multistrike_crit (blocked) 0.24 0.84% 3144.98 2899 4483 659.08 0 4483 742 1060 6.28
multistrike 8.02 73.10% 2245.00 2070 3202 2244.48 0 3202 18016 18016 0.00
multistrike (blocked) 0.66 2.36% 1572.05 1449 2242 760.85 0 2242 1037 1481 14.52
hit 18.93 67.60% 7485.35 6901 10674 7485.77 6901 8374 141674 141674 0.00
hit (blocked) 1.54 5.49% 5238.21 4831 7472 4138.29 0 7472 8046 11494 23.70
crit 6.97 24.90% 14963.63 13803 21348 14960.15 0 21348 104321 104321 0.00
crit (blocked) 0.56 2.02% 10506.21 9662 14944 4569.73 0 14944 5933 8476 13.04
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.9 26.92% 3047.32 2820 4361 3047.52 2826 3672 75908 75908 0.00
multistrike 67.6 73.08% 1523.58 1410 2181 1523.64 1426 1667 103009 103009 0.00
hit 159.7 73.10% 5078.86 4700 7269 5079.06 4903 5239 811046 811046 0.00
crit 58.8 26.90% 10155.48 9399 14538 10155.69 9519 11076 596650 596650 0.00
 
 

Action details: thrash_bear

Static Values
  • id:77758
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:77758
  • name:Thrash
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:Strikes all enemy targets within $A2 yards, dealing {$s1=1} bleed damage and an additional $o2 damage over {$d=16 seconds}. Each time Thrash deals damage, you gain ${$158723m1/10} Rage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.160600
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.109336
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - mirror_image_(trinket) 12117 / 4169
Felstorm 12117 9.3% 62.1 30.77sec 30159 3076 Periodic 370.5 3352 6704 4222 26.7% 0.7% 3.7% 155.7 1563 3125 26.9% 135.3%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.10 62.10 370.46 370.46 9.8058 1.6438 1872870.36 2739712.75 31.64 3075.58 3075.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 40.3 26.89% 3125.22 2611 3998 3127.37 2735 3607 125968 125968 0.00
multistrike_crit (blocked) 1.6 0.42% 3123.94 2611 3998 2454.86 0 3998 4851 4851 0.00
multistrike 109.6 73.11% 1563.13 1306 1999 1564.18 1439 1693 171313 171313 0.00
multistrike (blocked) 4.2 1.15% 1563.44 1306 1999 1538.59 0 1999 6639 6639 0.00
hit 258.8 69.86% 3390.18 2832 4336 3392.49 3255 3558 877369 1348377 34.93
hit (blocked) 10.0 2.70% 2374.24 1982 3035 2376.05 0 3035 23737 52114 54.45
crit 95.2 25.70% 6780.23 5664 8672 6784.76 6241 7368 645483 992006 34.93
crit (blocked) 3.7 1.00% 4746.79 3965 6070 4630.40 0 6070 17511 38445 53.08
parry 2.8 0.75% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: felstorm

Static Values
  • id:184279
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184279
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $184280m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:Strikes all nearby targets within $184280A1 yards for $184280m1% weapon damage every $t1 sec for {$d=20 seconds}. The Mirror Image cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: felstorm_tick

Static Values
  • id:184280
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184280
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc184279=Strikes all nearby targets within $184280A1 yards for $184280m1% weapon damage every $t1 sec for {$d=20 seconds}. The Mirror Image cannot perform any other abilities during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.50
 
Simple Action Stats Execute Interval
Thornpaw
Barkskin 8.0 60.06sec

Stats details: barkskin

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.04 8.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.88 73.17% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.16 26.83% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: barkskin

Static Values
  • id:22812
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bristling_fur.down
Spelldata
  • id:22812
  • name:Barkskin
  • school:nature
  • tooltip:All damage taken reduced by {$s2=20}%.
  • description:The Druid's skin becomes as tough as bark, reducing all damage taken by {$s2=20}%{$?s63057=false}[ and reducing chance to be critically hit by 25%][] for {$d=12 seconds}. While protected, damaging attacks will not cause spellcasting delays. Usable while stunned, frozen, incapacitated, feared, or asleep, and in all forms.
 
Bear Form 1.0 0.00sec

Stats details: bear_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.73 73.21% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.27 26.79% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: bear_form

Static Values
  • id:5487
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:2368.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:5487
  • name:Bear Form
  • school:physical
  • tooltip:Armor increased by $w3%. Stamina increased by {$1178s2=20}%. Immune to Polymorph effects.
  • description:Shapeshift into Bear Form, increasing armor by $m3% and Stamina by {$1178s2=20}%.{$?s16931=false}[ Also reduces all magical damage taken by {$16931s1=10}%, reduces the chance the Druid will be critically hit by {$16931s2=6}%, and reduces the chance for attacks to be parried by {$16931s3=3}%.][] Increases threat generation, protects the caster from Polymorph effects, and allows the use of various bear abilities. The act of shapeshifting frees the caster of movement impairing effects.
 
Berserk 2.9 185.15sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 2.91 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.13 73.09% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.78 26.91% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: berserk

Static Values
  • id:106952
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.pulverize.remains>10|!talent.pulverize.enabled)&buff.incarnation.down
Spelldata
  • id:106952
  • name:Berserk
  • school:physical
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
 
Burning Mirror 7.9 60.93sec

Stats details: burning_mirror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: burning_mirror

Static Values
  • id:184270
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:184270
  • name:Burning Mirror
  • school:arcane
  • tooltip:
  • description:Summons {$?s19574=false}[${$m1/2}][$m1] Mirror Images to attack your target and nearby enemies for {$184271d=20 seconds}.
 
Cenarion Ward 15.0 31.08sec

Stats details: cenarion_ward

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.01 15.01 0.00 0.00 1.1447 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.00 73.26% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.01 26.74% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: cenarion_ward

Static Values
  • id:102351
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2944.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:102351
  • name:Cenarion Ward
  • school:nature
  • tooltip:Taking damage will grant $w1 healing every $102352t sec for {$102352d=6 seconds}.
  • description:Protects a friendly target for {$d=30 seconds}. Any damage taken will consume the ward and heal the target for $102352o1 over {$102352d=6 seconds}.
 
Cenarion Ward (_hot) 14.9 30.85sec

Stats details: cenarion_ward_hot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 14.94 0.00 44.37 0.00 0.0000 2.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cenarion_ward_hot

Static Values
  • id:102352
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thornpaw
  • harmful:false
  • if_expr:
Spelldata
  • id:102352
  • name:Cenarion Ward
  • school:nature
  • tooltip:Heals $w1 damage every $t1 seconds.
  • description:Heals the target for $m1 every $t1 sec for {$d=6 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.933000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Frenzied Regeneration 19.0 23.36sec

Stats details: frenzied_regeneration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 19.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: frenzied_regeneration

Static Values
  • id:22842
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:39.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thornpaw
  • harmful:false
  • if_expr:rage>=80
Spelldata
  • id:22842
  • name:Frenzied Regeneration
  • school:physical
  • tooltip:
  • description:$?s54810[Increases healing received by {$122307s1=1}% for {$122307d=0 milliseconds}.][Instantly converts up to {$s2=60} Rage into up to {$s1=1} health.]
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:6.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Healing Touch 0.0 0.00sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 0.00 0.00 0.00 0.00 1.2434 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3312.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Thornpaw
  • harmful:false
  • if_expr:buff.dream_of_cenarius.react&health.pct<30
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}{$?s54825=false}[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.600000
  • spell_power_mod.direct:3.600000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
Savage Defense 36.3 12.17sec

Stats details: savage_defense

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.27 36.27 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.52 73.11% 0.00 0 0 0.00 0 0 0 0 0.00
crit 9.75 26.89% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: savage_defense

Static Values
  • id:62606
  • school:nature
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.barkskin.down
Spelldata
  • id:62606
  • name:Savage Defense
  • school:nature
  • tooltip:
  • description:Increases chance to dodge by {$132402s1=45}% and reduces Physical damage taken by {$132402s4=20}% for {$132402d=6 seconds}. Maximum 2 charges.
 
Skull Bash 12.3 38.15sec

Stats details: skull_bash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.25 12.25 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: skull_bash

Static Values
  • id:106839
  • school:physical
  • resource:none
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:106839
  • name:Skull Bash
  • school:physical
  • tooltip:
  • description:You charge and skull bash the target, interrupting spellcasting and preventing any spell in that school from being cast for {$93985d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Barkskin 8.0 0.0 60.1sec 60.1sec 21.18% 21.28% 0.0(0.0)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_barkskin
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.20

Stack Uptimes

  • barkskin_1:21.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:22812
  • name:Barkskin
  • tooltip:All damage taken reduced by {$s2=20}%.
  • description:The Druid's skin becomes as tough as bark, reducing all damage taken by {$s2=20}%{$?s63057=false}[ and reducing chance to be critically hit by 25%][] for {$d=12 seconds}. While protected, damaging attacks will not cause spellcasting delays. Usable while stunned, frozen, incapacitated, feared, or asleep, and in all forms.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:0.00%
Berserk 2.9 0.0 185.2sec 185.2sec 9.52% 29.48% 0.0(0.0)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserk_1:9.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106952
  • name:Berserk
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.03% 42.87% 0.0(0.0)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Cenarion Ward 15.0 0.0 31.0sec 31.1sec 5.32% 5.64% 0.0(0.0)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_cenarion_ward
  • max_stacks:1
  • duration:30.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • cenarion_ward_1:5.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:102351
  • name:Cenarion Ward
  • tooltip:Taking damage will grant $w1 healing every $102352t sec for {$102352d=6 seconds}.
  • description:Protects a friendly target for {$d=30 seconds}. Any damage taken will consume the ward and heal the target for $102352o1 over {$102352d=6 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:30.00
  • default_chance:100.00%
Dream of Cenarius 1.0 15.7 293.4sec 26.0sec 96.55% 96.59% 15.7(15.7)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_dream_of_cenarius
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-0.00

Stack Uptimes

  • dream_of_cenarius_1:96.55%

Trigger Attempt Success

  • trigger_pct:40.06%

Spelldata details

  • id:158501
  • name:Dream of Cenarius
  • tooltip:
  • description:Increases healing from Healing Touch by {$s2=20}%, increases the critical strike chance of Mangle by {$s3=10}%, and your Mangle critical strikes have a {$h=40}% chance to make your next Healing Touch or Rebirth instant, free, and castable in all forms, and to benefit from Attack Power instead of Spell Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:40.00%
Mark of Bleeding Hollow 13.0 7.3 35.7sec 22.3sec 43.25% 43.25% 7.3(7.3)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_mark_of_bleeding_hollow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:500.00

Stack Uptimes

  • mark_of_bleeding_hollow_1:43.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173322
  • name:Mark of Bleeding Hollow
  • tooltip:Mastery increased by $w1.
  • description:Mastery increased by {$s1=500}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Primal Tenacity 71.2 0.0 6.3sec 6.3sec 49.67% 50.00% 0.0(0.0)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_primal_tenacity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • primal_tenacity_1:49.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:155784
  • name:Primal Tenacity
  • tooltip:$?$w1=0:[When you are next hit by a physical attack, you will gain a physical absorb shield equal to $w2% of the attack's damage.][Absorbs $w1 physical damage.]
  • description:{$@spelldesc155783=When you are hit by a physical attack, you gain a physical absorb shield equal to $m1% of that hit's damage. Attacks which this effect fully or partially absorbs cannot trigger Primal Tenacity. Also increases your attack power by {$159195s1=0}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Pulverize 3.8 32.7 125.6sec 12.4sec 95.28% 95.79% 232.4(232.4)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_pulverize
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.15

Stack Uptimes

  • pulverize_1:95.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:158792
  • name:Pulverize
  • tooltip:Damage taken reduced by $s4%.
  • description:{$@spelldesc80313=A devastating blow that consumes 3 stacks of your Lacerate on the target to deal $sw1 Physical damage, and reduce damage taken by {$158792s1=15}% for {$158792d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Sanctus 4.3 0.0 120.7sec 120.6sec 14.23% 50.59% 0.0(0.0)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_sanctus
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.51

Stack Uptimes

  • sanctus_1:14.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187617
  • name:Sanctus
  • tooltip:Versatility increased by $w1%. All damage and healing taken is equally shared between empowered tanks.
  • description:{$@spelldesc187613=Awakens the powers of Sanctus rings worn by you and your allies, granting ${$m1/100}% Versatility for {$187617d=15 seconds}. For the duration of this effect, all damage and healing received is divided evenly among empowered allies. (2 min shared cooldown)}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Savage Defense 31.5 0.0 14.0sec 14.0sec 48.03% 46.76% 0.0(0.0)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_savage_defense
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.45

Stack Uptimes

  • savage_defense_1:48.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:132402
  • name:Savage Defense
  • tooltip:Increases chance to dodge by $w1% and reduces Physical damage taken by {$s4=20}%.
  • description:{$@spelldesc62606=Increases chance to dodge by {$132402s1=45}% and reduces Physical damage taken by {$132402s4=20}% for {$132402d=6 seconds}. Maximum 2 charges.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Tooth and Claw 48.5 40.8 9.2sec 5.0sec 56.30% 100.00% 4.2(4.2)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_tooth_and_claw
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tooth_and_claw_1:32.18%
  • tooth_and_claw_2:17.05%
  • tooth_and_claw_3:7.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135286
  • name:Tooth and Claw
  • tooltip:Your next Maul causes its victim's next autoattack to deal less damage.
  • description:{$@spelldesc135288=Your autoattacks in Bear Form have a {$h=40}% chance to empower your next Maul for {$135286d=10 seconds}. Empowered Maul causes its primary victim's next autoattack to deal ${$AP*2.4} less damage. You can accumulate up to {$?s157283=false}[${$m1+$157283m1}][$m1] charges of Tooth and Claw.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Tooth and Claw (_absorb) 70.0 12.5 6.4sec 5.4sec 41.81% 100.00% 12.5(12.5)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_tooth_and_claw_absorb
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • tooth_and_claw_absorb_1:41.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135597
  • name:Tooth and Claw
  • tooltip:Your next autoattack deals less damage.
  • description:{$@spelldesc135288=Your autoattacks in Bear Form have a {$h=40}% chance to empower your next Maul for {$135286d=10 seconds}. Empowered Maul causes its primary victim's next autoattack to deal ${$AP*2.4} less damage. You can accumulate up to {$?s157283=false}[${$m1+$157283m1}][$m1] charges of Tooth and Claw.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ursa Major 1.0 609.1 230.7sec 1.5sec 99.53% 100.00% 609.1(609.1)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_ursa_major
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • ursa_major_1:99.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159233
  • name:Ursa Major
  • tooltip:Maximum health increased by $w1%.
  • description:{$@spelldesc159232=Your auto attack multistrikes, Mangle multistrikes, and Lacerate periodic multistrikes grant you Ursa Major. Ursa Major increases your maximum health by {$159233s1=2}% for {$159233d=15 seconds}. When this effect is refreshed, the remaining portion is added to the new effect.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
Bear Form

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_bear_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bear_form_1:100.00%

Spelldata details

  • id:5487
  • name:Bear Form
  • tooltip:Armor increased by $w3%. Stamina increased by {$1178s2=20}%. Immune to Polymorph effects.
  • description:Shapeshift into Bear Form, increasing armor by $m3% and Stamina by {$1178s2=20}%.{$?s16931=false}[ Also reduces all magical damage taken by {$16931s1=10}%, reduces the chance the Druid will be critically hit by {$16931s2=6}%, and reduces the chance for attacks to be parried by {$16931s3=3}%.][] Increases threat generation, protects the caster from Polymorph effects, and allows the use of various bear abilities. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Bladed Armor

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_bladed_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bladed_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:161608
  • name:Bladed Armor
  • tooltip:
  • description:Increases your Attack Power by {$s1=100}% of your Bonus Armor.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Stance of the Fierce Tiger (fierce_tiger_movement_aura)

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_fierce_tiger_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fierce_tiger_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:
  • description:Increases all damage dealt by {$s3=10}%. Grants you and your allies within $m7 yards {$166646s1=10}% increased movement speed, and improves the functionality of Jab, Expel Harm, Tiger Palm, Blackout Kick, and Rising Sun Kick.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Draenic Agility Flask

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
resolve

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_resolve
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • resolve_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
sleeper_sushi_food

Buff details

  • buff initial source:Thornpaw
  • cooldown name:buff_sleeper_sushi_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:125.00

Stack Uptimes

  • sleeper_sushi_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Thornpaw
cenarion_ward Mana 15.0 41251.6 2747.9 2747.9 0.0
frenzied_regeneration Rage 19.0 1039.1 54.6 54.6 0.0
maul Rage 82.5 1649.0 20.0 20.0 723.8
savage_defense Rage 36.3 2176.4 60.0 60.0 0.0
Resource Gains Type Count Total Average Overflow
primal_tenacity Health 70.95 2886715.44 (29.35%) 40689.04 0.00 0.00%
tooth_and_claw_absorb Health 69.50 2844007.64 (28.92%) 40919.12 0.00 0.00%
stalwart_guardian Health 265.03 4103580.50 (41.73%) 15483.40 0.00 0.00%
bear_melee Rage 223.32 1111.59 (22.64%) 4.98 4.99 0.45%
lacerate Rage 560.64 356.06 (7.25%) 0.64 1.54 0.43%
thrash_bear Rage 246.44 245.59 (5.00%) 1.00 0.85 0.35%
mangle Rage 112.84 1684.67 (34.31%) 14.93 7.92 0.47%
energy_regen Energy 962.42 0.00 (0.00%) 0.00 5588.90 100.00%
mp5_regen Mana 962.42 40891.38 (100.00%) 42.49 189313.92 82.24%
bear_form Rage 1.00 10.00 (0.20%) 10.00 0.00 0.00%
primal_fury Rage 189.23 1502.62 (30.60%) 7.94 11.22 0.74%
guardian_tier18_2pc Health 65.76 0.00 (0.00%) 0.00 573826.17 100.00%
Resource RPS-Gain RPS-Loss
Health 13676.64 12781.39
Mana 90.87 91.67
Rage 10.91 11.03
Combat End Resource Mean Min Max
Mana 31615.30 29056.00 32000.00
Rage 35.48 0.00 100.00
Energy 100.00 100.00 100.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.5%

Procs

Count Interval
primal_fury 189.2 2.4sec
tooth_and_claw 89.3 5.0sec
tooth_and_claw_wasted 4.2 55.8sec
ursa_major 304.1 1.6sec

Statistics & Data Analysis

Fight Length
Sample Data Thornpaw Fight Length
Count 24999
Mean 450.01
Minimum 351.82
Maximum 558.10
Spread ( max - min ) 206.27
Range [ ( max - min ) / 2 * 100% ] 22.92%
DPS
Sample Data Thornpaw Damage Per Second
Count 24999
Mean 44677.18
Minimum 41989.98
Maximum 47718.81
Spread ( max - min ) 5728.83
Range [ ( max - min ) / 2 * 100% ] 6.41%
Standard Deviation 739.8066
5th Percentile 43511.29
95th Percentile 45955.09
( 95th Percentile - 5th Percentile ) 2443.80
Mean Distribution
Standard Deviation 4.6790
95.00% Confidence Intervall ( 44668.01 - 44686.35 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 1053
0.1 Scale Factor Error with Delta=300 4672
0.05 Scale Factor Error with Delta=300 18688
0.01 Scale Factor Error with Delta=300 467218
Priority Target DPS
Sample Data Thornpaw Priority Target Damage Per Second
Count 24999
Mean 44677.18
Minimum 41989.98
Maximum 47718.81
Spread ( max - min ) 5728.83
Range [ ( max - min ) / 2 * 100% ] 6.41%
Standard Deviation 739.8066
5th Percentile 43511.29
95th Percentile 45955.09
( 95th Percentile - 5th Percentile ) 2443.80
Mean Distribution
Standard Deviation 4.6790
95.00% Confidence Intervall ( 44668.01 - 44686.35 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 1053
0.1 Scale Factor Error with Delta=300 4672
0.05 Scale Factor Error with Delta=300 18688
0.01 Scale Factor Error with Delta=300 467218
DPS(e)
Sample Data Thornpaw Damage Per Second (Effective)
Count 24999
Mean 44677.18
Minimum 41989.98
Maximum 47718.81
Spread ( max - min ) 5728.83
Range [ ( max - min ) / 2 * 100% ] 6.41%
Damage
Sample Data Thornpaw Damage
Count 24999
Mean 18217093.33
Minimum 13921306.56
Maximum 23079367.14
Spread ( max - min ) 9158060.58
Range [ ( max - min ) / 2 * 100% ] 25.14%
DTPS
Sample Data Thornpaw Damage Taken Per Second
Count 24999
Mean 12778.06
Minimum 10199.57
Maximum 16292.19
Spread ( max - min ) 6092.62
Range [ ( max - min ) / 2 * 100% ] 23.84%
Standard Deviation 715.2157
5th Percentile 11623.78
95th Percentile 13970.83
( 95th Percentile - 5th Percentile ) 2347.04
Mean Distribution
Standard Deviation 4.5235
95.00% Confidence Intervall ( 12769.19 - 12786.92 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 12034
0.1 Scale Factor Error with Delta=300 4366
0.05 Scale Factor Error with Delta=300 17466
0.01 Scale Factor Error with Delta=300 436674
HPS
Sample Data Thornpaw Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Thornpaw Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Thornpaw Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Thornpaw Healing Taken Per Second
Count 24999
Mean 10248.04
Minimum 7582.81
Maximum 13445.50
Spread ( max - min ) 5862.69
Range [ ( max - min ) / 2 * 100% ] 28.60%
TMI
Sample Data Thornpaw Theck-Meloree Index
Count 24999
Mean 67045.17
Minimum 63559.45
Maximum 71395.39
Spread ( max - min ) 7835.95
Range [ ( max - min ) / 2 * 100% ] 5.84%
Standard Deviation 995.1788
5th Percentile 65451.24
95th Percentile 68706.95
( 95th Percentile - 5th Percentile ) 3255.72
Mean Distribution
Standard Deviation 6.2942
95.00% Confidence Intervall ( 67032.84 - 67057.51 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 846
0.1 Scale Factor Error with Delta=300 8454
0.05 Scale Factor Error with Delta=300 33817
0.01 Scale Factor Error with Delta=300 845446
ETMI
Sample Data ThornpawTheck-Meloree Index (Effective)
Count 24999
Mean 67843.62
Minimum 65221.98
Maximum 71686.75
Spread ( max - min ) 6464.78
Range [ ( max - min ) / 2 * 100% ] 4.76%
Standard Deviation 774.7633
5th Percentile 66637.30
95th Percentile 69176.00
( 95th Percentile - 5th Percentile ) 2538.70
Mean Distribution
Standard Deviation 4.9001
95.00% Confidence Intervall ( 67834.01 - 67853.22 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 5
0.1% Error 500
0.1 Scale Factor Error with Delta=300 5124
0.05 Scale Factor Error with Delta=300 20496
0.01 Scale Factor Error with Delta=300 512414
MSD
Sample Data Thornpaw Max Spike Value
Count 6267
Mean 29.82
Minimum 18.15
Maximum 44.94
Spread ( max - min ) 26.79
Range [ ( max - min ) / 2 * 100% ] 44.93%
Standard Deviation 3.8725
5th Percentile 24.22
95th Percentile 36.84
( 95th Percentile - 5th Percentile ) 12.62
Mean Distribution
Standard Deviation 0.0489
95.00% Confidence Intervall ( 29.72 - 29.92 )
Normalized 95.00% Confidence Intervall ( 99.68% - 100.32% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 647
0.1% Error 64781
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 12

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=sleeper_sushi
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 bear_form
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 cenarion_ward
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_attack
7 12.26 skull_bash
8 36.27 savage_defense,if=buff.barkskin.down
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent
9 4.35 use_item,slot=finger1
A 7.94 use_item,slot=trinket1
B 8.04 barkskin,if=buff.bristling_fur.down
0.00 bristling_fur,if=buff.barkskin.down&buff.savage_defense.down
C 82.45 maul,if=buff.tooth_and_claw.react&incoming_damage_1s
D 2.91 berserk,if=(buff.pulverize.remains>10|!talent.pulverize.enabled)&buff.incarnation.down
E 19.03 frenzied_regeneration,if=rage>=80
F 14.01 cenarion_ward
0.00 renewal,if=health.pct<30
0.00 heart_of_the_wild
0.00 rejuvenation,if=buff.heart_of_the_wild.up&remains<=3.6
0.00 natures_vigil
G 0.00 healing_touch,if=buff.dream_of_cenarius.react&health.pct<30
H 36.44 pulverize,if=buff.pulverize.remains<=3.6
I 11.33 lacerate,if=talent.pulverize.enabled&buff.pulverize.remains<=(3-dot.lacerate.stack)*gcd&buff.berserk.down
0.00 incarnation,if=buff.berserk.down
J 36.33 lacerate,if=!ticking
K 5.55 thrash_bear,if=!ticking
L 112.84 mangle
M 22.44 thrash_bear,if=remains<=4.8
N 131.14 lacerate

Sample Sequence

013569ABII7IHDJCKLCLLLELL8LL8LCLLCLLCEIICIHJ8KLNNNLEFHCJLNN8CMLNN7NLCENHJCLN8NCLNMNHJCLNEBALCFNNLNHEJLMNL8NCN7NLCHJCLM8NNCLNCNHCFJLN8NNLMN8HJLNLENNNL87HJMLNBC9ANENFLNCHJCLNEMNLN8LCNHCJLNCNLNL8MHC7JLCFNN8LNNCLH8JLMNNELNCLNH8JLCNBMANCLNFHDJE7LLLEL8LCLLL8LKLLEIIIC7H8JLCNCMNLFECHJLCNCLNL8NMCHJLN8LCNNNCLBN9HAJCLEMNFLCNN8HJCLNCNLMCNNC7LHJ8NCLNNNL8NMHFJLCNNCL8NLHJNCL8MCNNCLNCNBHJALNENCNLCFMH8JLCNLNN8NLNCHJL8KNNCLNNCN7HJL8FMNLNNHEJLN8NNLMNNCBH9JLEANNCLNNNECFHC7DJLCKLL8LCLL8CLLCLLELCI8IIHJKCLNNNEFCHJL8NLM7NCNLEHCJN8LBNLNMANCLEHJLN8NFLNCNHJL8M

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre bear_form Fluffy_Pillow 32000.0/32000: 100% mana | 10.0/100: 10% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 10.0/100: 10% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points cenarion_ward
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward
0:00.000 use_item_sanctus_sigil_of_the_unbroken Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward
0:00.000 use_item_mirror_of_the_blademaster Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward, sanctus
0:00.000 barkskin Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward, sanctus
0:00.000 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward, barkskin, sanctus
0:01.244 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 10.0/100: 10% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, cenarion_ward, barkskin, sanctus, mark_of_bleeding_hollow
0:02.248 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, cenarion_ward, barkskin, ursa_major, sanctus, mark_of_bleeding_hollow
0:02.248 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, cenarion_ward, barkskin, ursa_major, sanctus, mark_of_bleeding_hollow
0:03.254 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 19.0/100: 19% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, cenarion_ward, barkskin, ursa_major, sanctus, mark_of_bleeding_hollow
0:04.257 berserk Fluffy_Pillow 32000.0/32000: 100% mana | 32.0/100: 32% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, sanctus, mark_of_bleeding_hollow
0:04.257 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 32.0/100: 32% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, sanctus, mark_of_bleeding_hollow
0:04.357 maul Fluffy_Pillow 32000.0/32000: 100% mana | 14.0/100: 14% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus, mark_of_bleeding_hollow
0:05.261 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 19.0/100: 19% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus, mark_of_bleeding_hollow
0:06.265 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, barkskin, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
0:07.165 maul Fluffy_Pillow 32000.0/32000: 100% mana | 28.0/100: 28% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus, mark_of_bleeding_hollow
0:07.268 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 29.0/100: 29% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus, mark_of_bleeding_hollow
0:08.272 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 49.0/100: 49% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, barkskin, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
0:09.277 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 73.0/100: 73% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, barkskin, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
0:09.277 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 28.0/100: 28% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, barkskin, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
0:10.280 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 33.0/100: 33% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, barkskin, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
0:11.285 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 49.0/100: 49% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, barkskin, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
0:12.085 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, sanctus, mark_of_bleeding_hollow
0:12.289 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, sanctus, mark_of_bleeding_hollow
0:13.295 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, sanctus
0:13.595 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/100: 1% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, sanctus
0:14.301 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/100: 1% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, sanctus
0:15.001 maul Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:15.306 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:16.311 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:17.011 maul Fluffy_Pillow 32000.0/32000: 100% mana | 57.0/100: 57% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw_absorb, ursa_major
0:17.316 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 58.0/100: 58% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw_absorb, ursa_major
0:18.321 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 78.0/100: 78% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:19.021 maul Fluffy_Pillow 32000.0/32000: 100% mana | 80.0/100: 80% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw_absorb, ursa_major
0:19.021 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw_absorb, ursa_major
0:19.326 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 56.0/100: 56% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw_absorb, ursa_major
0:20.331 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 58.0/100: 58% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw_absorb, ursa_major
0:21.331 maul Fluffy_Pillow 32000.0/32000: 100% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw_absorb, ursa_major
0:21.336 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw_absorb, ursa_major
0:22.341 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 48.0/100: 48% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw_absorb, ursa_major
0:23.346 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 53.0/100: 53% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
0:24.146 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:24.349 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:25.354 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:26.358 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), ursa_major
0:27.361 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 53.0/100: 53% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), ursa_major
0:28.365 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 64.0/100: 64% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), ursa_major
0:29.368 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 71.0/100: 71% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), ursa_major
0:29.368 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 56.0/100: 56% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), ursa_major
0:30.373 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 57.0/100: 57% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, tooth_and_claw(2), ursa_major
0:31.379 pulverize Fluffy_Pillow 29571.1/32000: 92% mana | 62.0/100: 62% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, cenarion_ward, dream_of_cenarius, pulverize, tooth_and_claw(2), ursa_major
0:32.079 maul Fluffy_Pillow 29929.5/32000: 94% mana | 55.0/100: 55% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:32.385 lacerate Fluffy_Pillow 30086.1/32000: 94% mana | 56.0/100: 56% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:33.388 mangle Fluffy_Pillow 30599.7/32000: 96% mana | 58.0/100: 58% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:34.392 lacerate Fluffy_Pillow 31113.7/32000: 97% mana | 79.0/100: 79% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, tooth_and_claw(2), ursa_major
0:35.398 lacerate Fluffy_Pillow 31628.8/32000: 99% mana | 94.0/100: 94% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, tooth_and_claw(2), ursa_major
0:36.098 savage_defense Fluffy_Pillow 31987.2/32000: 100% mana | 36.0/100: 36% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), ursa_major
0:36.098 maul Fluffy_Pillow 31987.2/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:36.403 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:37.408 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
0:38.414 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 44.0/100: 44% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
0:39.419 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
0:40.424 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 62.0/100: 62% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(3), ursa_major
0:40.424 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 62.0/100: 62% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
0:41.429 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 64.0/100: 64% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
0:42.029 maul Fluffy_Pillow 32000.0/32000: 100% mana | 80.0/100: 80% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
0:42.029 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
0:42.671 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 51.0/100: 51% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
0:43.914 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 58.0/100: 58% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
0:45.156 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 59.0/100: 59% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
0:46.056 maul Fluffy_Pillow 32000.0/32000: 100% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
0:46.399 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 47.0/100: 47% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
0:47.645 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 70.0/100: 70% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
0:48.145 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
0:48.888 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
0:48.888 maul Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
0:50.131 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 13.0/100: 13% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
0:51.375 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 37.0/100: 37% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
0:52.619 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 45.0/100: 45% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
0:53.861 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
0:55.106 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major
0:56.348 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 59.0/100: 59% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, ursa_major
0:56.548 maul Fluffy_Pillow 32000.0/32000: 100% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
0:57.592 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
0:58.835 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 79.0/100: 79% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major
0:58.835 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major
1:00.035 barkskin Fluffy_Pillow 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, ursa_major
1:00.079 use_item_mirror_of_the_blademaster Fluffy_Pillow 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, ursa_major
1:00.079 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, ursa_major
1:00.479 maul Fluffy_Pillow 32000.0/32000: 100% mana | 22.0/100: 22% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
1:01.321 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 22.0/100: 22% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
1:02.565 lacerate Fluffy_Pillow 29692.9/32000: 93% mana | 28.0/100: 28% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major
1:03.809 lacerate Fluffy_Pillow 30329.9/32000: 95% mana | 38.0/100: 38% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major
1:05.052 mangle Fluffy_Pillow 30966.3/32000: 97% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major
1:06.296 lacerate Fluffy_Pillow 31603.2/32000: 99% mana | 66.0/100: 66% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, ursa_major
1:07.540 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 69.0/100: 69% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, ursa_major
1:08.440 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major
1:08.785 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major
1:10.028 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 25.0/100: 25% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, ursa_major
1:11.271 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, ursa_major
1:12.513 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 53.0/100: 53% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, ursa_major
1:13.757 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 55.0/100: 55% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, ursa_major
1:13.757 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 10.0/100: 10% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
1:15.001 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), ursa_major, mark_of_bleeding_hollow
1:16.001 maul Fluffy_Pillow 32000.0/32000: 100% mana | 14.0/100: 14% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:16.243 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 14.0/100: 14% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:17.487 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 22.0/100: 22% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:17.487 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 22.0/100: 22% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:18.731 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 38.0/100: 38% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
1:19.031 maul Fluffy_Pillow 32000.0/32000: 100% mana | 33.0/100: 33% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:19.974 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 33.0/100: 33% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:21.219 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 39.0/100: 39% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
1:22.019 maul Fluffy_Pillow 32000.0/32000: 100% mana | 29.0/100: 29% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:22.463 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 30.0/100: 30% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:23.708 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(3), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:24.408 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
1:24.951 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
1:26.194 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 15.0/100: 15% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
1:26.994 maul Fluffy_Pillow 32000.0/32000: 100% mana | 11.0/100: 11% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:27.439 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 11.0/100: 11% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:28.682 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 35.0/100: 35% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:29.482 maul Fluffy_Pillow 32000.0/32000: 100% mana | 30.0/100: 30% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:29.927 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 30.0/100: 30% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:31.169 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 38.0/100: 38% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:31.969 maul Fluffy_Pillow 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
1:32.413 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 27.0/100: 27% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
1:33.657 lacerate Fluffy_Pillow 29692.9/32000: 93% mana | 32.0/100: 32% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
1:34.900 mangle Fluffy_Pillow 30329.3/32000: 95% mana | 35.0/100: 35% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
1:36.145 lacerate Fluffy_Pillow 30966.8/32000: 97% mana | 55.0/100: 55% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
1:36.145 savage_defense Fluffy_Pillow 30966.8/32000: 97% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:37.389 lacerate Fluffy_Pillow 31603.7/32000: 99% mana | 11.0/100: 11% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:38.631 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 14.0/100: 14% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:39.874 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:41.118 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 37.0/100: 37% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:42.361 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 52.0/100: 52% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
1:42.361 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/100: 2% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:43.604 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 7.0/100: 7% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:44.848 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:46.093 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:47.337 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 47.0/100: 47% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:48.581 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 63.0/100: 63% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
1:48.581 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
1:49.824 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 31.0/100: 31% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
1:51.067 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 34.0/100: 34% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
1:52.310 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 41.0/100: 41% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, mark_of_bleeding_hollow
1:53.554 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 44.0/100: 44% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, mark_of_bleeding_hollow
1:53.854 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/100: 4% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:54.797 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:54.797 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
1:56.039 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major
1:57.283 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major
1:58.527 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 44.0/100: 44% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
1:59.771 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 59.0/100: 59% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
2:00.071 barkskin Fluffy_Pillow 32000.0/32000: 100% mana | 82.0/100: 82% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major
2:00.071 maul Fluffy_Pillow 32000.0/32000: 100% mana | 62.0/100: 62% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
2:01.015 use_item_sanctus_sigil_of_the_unbroken Fluffy_Pillow 32000.0/32000: 100% mana | 63.0/100: 63% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
2:01.015 use_item_mirror_of_the_blademaster Fluffy_Pillow 32000.0/32000: 100% mana | 63.0/100: 63% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
2:01.015 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 63.0/100: 63% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
2:02.115 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
2:02.258 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
2:03.501 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 29.0/100: 29% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
2:04.744 mangle Fluffy_Pillow 29692.4/32000: 93% mana | 43.0/100: 43% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, sanctus
2:05.989 lacerate Fluffy_Pillow 30329.9/32000: 95% mana | 66.0/100: 66% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, sanctus
2:06.089 maul Fluffy_Pillow 30381.1/32000: 95% mana | 56.0/100: 56% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
2:07.233 pulverize Fluffy_Pillow 30966.8/32000: 97% mana | 62.0/100: 62% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
2:08.477 lacerate Fluffy_Pillow 31603.7/32000: 99% mana | 68.0/100: 68% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, sanctus
2:08.677 maul Fluffy_Pillow 31706.1/32000: 99% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
2:09.720 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus, mark_of_bleeding_hollow
2:10.964 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 79.0/100: 79% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
2:10.964 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
2:12.206 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
2:13.451 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 28.0/100: 28% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
2:14.694 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 44.0/100: 44% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
2:15.937 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 59.0/100: 59% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, sanctus, mark_of_bleeding_hollow
2:15.937 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/100: 1% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, sanctus, mark_of_bleeding_hollow
2:17.181 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 7.0/100: 7% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
2:18.081 maul Fluffy_Pillow 32000.0/32000: 100% mana | 10.0/100: 10% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
2:18.425 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 11.0/100: 11% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
2:19.668 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
2:20.668 maul Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/100: 4% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
2:20.911 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/100: 4% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
2:22.154 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 6.0/100: 6% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
2:23.397 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 35.0/100: 35% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
2:24.097 maul Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
2:24.640 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
2:25.883 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 33.0/100: 33% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
2:27.125 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
2:28.368 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 57.0/100: 57% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, mark_of_bleeding_hollow
2:28.368 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 12.0/100: 12% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
2:29.611 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
2:30.853 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 19.0/100: 19% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major
2:32.053 maul Fluffy_Pillow 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
2:32.095 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
2:32.095 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
2:33.338 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 28.0/100: 28% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
2:34.538 maul Fluffy_Pillow 32000.0/32000: 100% mana | 32.0/100: 32% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
2:34.582 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 32.0/100: 32% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
2:35.826 lacerate Fluffy_Pillow 29692.9/32000: 93% mana | 37.0/100: 37% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward, dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
2:37.071 lacerate Fluffy_Pillow 30330.4/32000: 95% mana | 48.0/100: 48% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major
2:37.171 savage_defense Fluffy_Pillow 30381.6/32000: 95% mana | 3.0/100: 3% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
2:38.314 mangle Fluffy_Pillow 30966.8/32000: 97% mana | 3.0/100: 3% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
2:39.557 lacerate Fluffy_Pillow 31603.2/32000: 99% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
2:40.801 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 27.0/100: 27% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
2:42.001 maul Fluffy_Pillow 32000.0/32000: 100% mana | 30.0/100: 30% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
2:42.043 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 30.0/100: 30% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
2:43.288 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
2:43.288 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/100: 2% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
2:44.532 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 8.0/100: 8% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major
2:45.775 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major
2:47.020 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 47.0/100: 47% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major
2:48.264 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 61.0/100: 61% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major
2:49.507 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 72.0/100: 72% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major
2:50.407 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major
2:50.750 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major
2:51.993 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 40.0/100: 40% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, ursa_major
2:52.093 maul Fluffy_Pillow 32000.0/32000: 100% mana | 22.0/100: 22% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
2:53.236 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
2:54.480 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 44.0/100: 44% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, mark_of_bleeding_hollow
2:55.723 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, mark_of_bleeding_hollow
2:55.723 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/100: 2% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
2:56.968 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 8.0/100: 8% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
2:58.210 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
2:59.110 maul Fluffy_Pillow 32000.0/32000: 100% mana | 19.0/100: 19% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
2:59.453 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 19.0/100: 19% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
3:00.153 barkskin Fluffy_Pillow 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
3:00.698 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 27.0/100: 27% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
3:01.941 use_item_mirror_of_the_blademaster Fluffy_Pillow 32000.0/32000: 100% mana | 49.0/100: 49% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
3:01.941 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 49.0/100: 49% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
3:03.141 maul Fluffy_Pillow 32000.0/32000: 100% mana | 32.0/100: 32% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
3:03.183 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 32.0/100: 32% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
3:04.427 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 61.0/100: 61% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major, mark_of_bleeding_hollow
3:05.671 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 63.0/100: 63% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major
3:06.913 pulverize Fluffy_Pillow 29691.9/32000: 93% mana | 69.0/100: 69% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, ursa_major
3:08.155 berserk Fluffy_Pillow 30327.8/32000: 95% mana | 74.0/100: 74% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major
3:08.155 lacerate Fluffy_Pillow 30327.8/32000: 95% mana | 74.0/100: 74% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, barkskin, pulverize, ursa_major
3:08.155 frenzied_regeneration Thornpaw 30327.8/32000: 95% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, barkskin, pulverize, ursa_major
3:09.399 skull_bash Fluffy_Pillow 30964.7/32000: 97% mana | 25.0/100: 25% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, barkskin, pulverize, ursa_major
3:09.399 mangle Fluffy_Pillow 30964.7/32000: 97% mana | 25.0/100: 25% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, barkskin, pulverize, ursa_major
3:10.641 mangle Fluffy_Pillow 31600.6/32000: 99% mana | 62.0/100: 62% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, barkskin, pulverize, ursa_major
3:11.886 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 77.0/100: 77% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, barkskin, pulverize, ursa_major
3:11.886 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 32.0/100: 32% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, barkskin, pulverize, ursa_major
3:13.130 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 38.0/100: 38% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, ursa_major
3:13.130 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/100: 1% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, ursa_major
3:14.373 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 15.0/100: 15% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major
3:14.773 maul Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
3:15.618 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
3:16.860 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 39.0/100: 39% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
3:18.104 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
3:18.104 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 9.0/100: 9% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
3:19.349 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
3:20.592 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 44.0/100: 44% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
3:21.833 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 45.0/100: 45% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
3:23.076 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 66.0/100: 66% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, savage_defense, tooth_and_claw(2), ursa_major
3:23.076 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 59.0/100: 59% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, savage_defense, tooth_and_claw(2), ursa_major
3:24.320 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 59.0/100: 59% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, savage_defense, tooth_and_claw(2), ursa_major
3:25.566 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 67.0/100: 67% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, tooth_and_claw(2), ursa_major
3:26.810 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 83.0/100: 83% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, tooth_and_claw(2), ursa_major
3:28.010 maul Fluffy_Pillow 32000.0/32000: 100% mana | 65.0/100: 65% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:28.055 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 65.0/100: 65% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:28.055 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 65.0/100: 65% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:28.455 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:29.297 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 11.0/100: 11% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:30.540 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 13.0/100: 13% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major
3:30.540 maul Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
3:31.785 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 22.0/100: 22% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:33.030 maul Fluffy_Pillow 32000.0/32000: 100% mana | 38.0/100: 38% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
3:33.030 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
3:34.275 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 27.0/100: 27% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
3:35.518 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 51.0/100: 51% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major
3:36.763 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 67.0/100: 67% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major
3:37.063 frenzied_regeneration Thornpaw 29209.6/32000: 91% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward, dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, ursa_major
3:38.006 maul Fluffy_Pillow 29692.4/32000: 93% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, ursa_major
3:38.006 pulverize Fluffy_Pillow 29692.4/32000: 93% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major
3:39.249 lacerate Fluffy_Pillow 30328.8/32000: 95% mana | 6.0/100: 6% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:40.492 mangle Fluffy_Pillow 30965.2/32000: 97% mana | 8.0/100: 8% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, ursa_major
3:40.492 maul Fluffy_Pillow 30965.2/32000: 97% mana | 11.0/100: 11% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
3:41.735 lacerate Fluffy_Pillow 31601.7/32000: 99% mana | 25.0/100: 25% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:42.979 maul Fluffy_Pillow 32000.0/32000: 100% mana | 36.0/100: 36% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, ursa_major
3:42.979 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major
3:44.223 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 36.0/100: 36% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, ursa_major
3:45.468 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 52.0/100: 52% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, ursa_major
3:45.468 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 15.0/100: 15% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major
3:46.713 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
3:47.955 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), ursa_major
3:48.155 maul Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/100: 4% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:49.199 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:50.445 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 10.0/100: 10% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major
3:51.686 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 34.0/100: 34% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), ursa_major
3:52.930 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 58.0/100: 58% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), ursa_major
3:52.930 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(2), ursa_major
3:54.173 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 13.0/100: 13% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), ursa_major
3:54.173 maul Fluffy_Pillow 32000.0/32000: 100% mana | 8.0/100: 8% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:55.417 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 9.0/100: 9% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:56.661 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:57.903 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 32.0/100: 32% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
3:59.103 maul Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
3:59.145 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major
4:00.245 barkskin Fluffy_Pillow 32000.0/32000: 100% mana | 51.0/100: 51% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major
4:00.388 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 51.0/100: 51% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major
4:01.631 use_item_sanctus_sigil_of_the_unbroken Fluffy_Pillow 32000.0/32000: 100% mana | 62.0/100: 62% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major
4:01.631 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 62.0/100: 62% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major, sanctus
4:02.874 use_item_mirror_of_the_blademaster Fluffy_Pillow 32000.0/32000: 100% mana | 76.0/100: 76% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major, sanctus
4:02.874 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 76.0/100: 76% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major, sanctus
4:04.074 maul Fluffy_Pillow 32000.0/32000: 100% mana | 71.0/100: 71% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
4:04.117 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 71.0/100: 71% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
4:04.117 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 34.0/100: 34% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
4:05.362 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 35.0/100: 35% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
4:06.605 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 42.0/100: 42% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major, sanctus
4:07.847 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 44.0/100: 44% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major, sanctus
4:09.092 mangle Fluffy_Pillow 29693.4/32000: 93% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward, dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major, sanctus
4:10.092 maul Fluffy_Pillow 30205.4/32000: 94% mana | 66.0/100: 66% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
4:10.336 lacerate Fluffy_Pillow 30330.4/32000: 95% mana | 66.0/100: 66% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
4:11.578 lacerate Fluffy_Pillow 30966.3/32000: 97% mana | 69.0/100: 69% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
4:12.278 savage_defense Fluffy_Pillow 31324.7/32000: 98% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major, sanctus
4:12.823 pulverize Fluffy_Pillow 31603.7/32000: 99% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major, sanctus
4:14.066 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major, sanctus
4:15.166 maul Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
4:15.310 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
4:16.553 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 33.0/100: 33% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
4:17.653 maul Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
4:17.796 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
4:19.037 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
4:20.281 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 39.0/100: 39% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
4:21.181 maul Fluffy_Pillow 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:21.525 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:22.768 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 34.0/100: 34% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), ursa_major, mark_of_bleeding_hollow
4:23.668 maul Fluffy_Pillow 32000.0/32000: 100% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:24.013 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:24.013 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:25.258 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 45.0/100: 45% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:26.502 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 53.0/100: 53% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:26.602 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 9.0/100: 9% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:27.744 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 9.0/100: 9% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:28.744 maul Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:28.985 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:30.228 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 28.0/100: 28% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:31.469 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 36.0/100: 36% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:32.712 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 39.0/100: 39% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:33.955 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:33.955 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/100: 1% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:35.198 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 7.0/100: 7% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:36.441 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 9.0/100: 9% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:37.683 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:38.926 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 25.0/100: 25% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:40.170 lacerate Fluffy_Pillow 29692.9/32000: 93% mana | 30.0/100: 30% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
4:41.414 mangle Fluffy_Pillow 30329.9/32000: 95% mana | 38.0/100: 38% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(3), ursa_major
4:42.014 maul Fluffy_Pillow 30637.1/32000: 96% mana | 41.0/100: 41% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
4:42.659 lacerate Fluffy_Pillow 30967.3/32000: 97% mana | 42.0/100: 42% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:43.902 lacerate Fluffy_Pillow 31603.7/32000: 99% mana | 49.0/100: 49% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:44.502 maul Fluffy_Pillow 31910.9/32000: 100% mana | 39.0/100: 39% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:45.145 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 40.0/100: 40% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:45.245 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:46.391 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:47.634 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:48.877 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 40.0/100: 40% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:50.120 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 45.0/100: 45% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
4:51.361 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 48.0/100: 48% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
4:52.061 maul Fluffy_Pillow 32000.0/32000: 100% mana | 51.0/100: 51% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:52.605 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 52.0/100: 52% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:52.605 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 15.0/100: 15% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:53.849 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:54.549 maul Fluffy_Pillow 32000.0/32000: 100% mana | 9.0/100: 9% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:55.093 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 10.0/100: 10% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:56.336 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:57.036 maul Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
4:57.579 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
4:58.822 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 29.0/100: 29% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, ursa_major
5:00.022 maul Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:00.065 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:00.265 barkskin Fluffy_Pillow 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:01.310 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 27.0/100: 27% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:02.557 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 32.0/100: 32% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:03.801 use_item_mirror_of_the_blademaster Fluffy_Pillow 32000.0/32000: 100% mana | 48.0/100: 48% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:03.801 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 48.0/100: 48% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:05.045 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 72.0/100: 72% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major, mark_of_bleeding_hollow
5:05.845 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 27.0/100: 27% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
5:06.289 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 27.0/100: 27% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
5:06.389 maul Fluffy_Pillow 32000.0/32000: 100% mana | 9.0/100: 9% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:07.531 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 10.0/100: 10% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:08.773 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
5:08.873 maul Fluffy_Pillow 32000.0/32000: 100% mana | 37.0/100: 37% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:10.018 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 42.0/100: 42% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major, mark_of_bleeding_hollow
5:11.262 thrash_bear Fluffy_Pillow 29692.9/32000: 93% mana | 43.0/100: 43% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major, mark_of_bleeding_hollow
5:12.507 pulverize Fluffy_Pillow 30330.4/32000: 95% mana | 57.0/100: 57% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
5:12.507 savage_defense Fluffy_Pillow 30330.4/32000: 95% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:13.752 lacerate Fluffy_Pillow 30967.8/32000: 97% mana | 6.0/100: 6% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:14.995 mangle Fluffy_Pillow 31604.2/32000: 99% mana | 14.0/100: 14% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
5:16.095 maul Fluffy_Pillow 32000.0/32000: 100% mana | 9.0/100: 9% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:16.237 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 22.0/100: 22% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:17.480 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 33.0/100: 33% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:18.725 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:19.968 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 56.0/100: 56% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:20.368 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 11.0/100: 11% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:21.211 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 12.0/100: 12% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:22.455 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 27.0/100: 27% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
5:23.699 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 43.0/100: 43% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
5:24.099 maul Fluffy_Pillow 32000.0/32000: 100% mana | 33.0/100: 33% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
5:24.942 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 39.0/100: 39% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
5:26.187 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 39.0/100: 39% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major
5:27.433 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 47.0/100: 47% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, mark_of_bleeding_hollow
5:28.433 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/100: 2% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:28.678 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
5:29.922 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
5:31.165 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 25.0/100: 25% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
5:32.065 maul Fluffy_Pillow 32000.0/32000: 100% mana | 7.0/100: 7% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:32.409 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 7.0/100: 7% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:33.653 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 36.0/100: 36% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:34.895 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 44.0/100: 44% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
5:35.195 maul Fluffy_Pillow 32000.0/32000: 100% mana | 34.0/100: 34% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
5:36.139 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 34.0/100: 34% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, mark_of_bleeding_hollow
5:37.383 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, mark_of_bleeding_hollow
5:37.383 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, mark_of_bleeding_hollow
5:38.627 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 50.0/100: 50% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
5:39.869 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 58.0/100: 58% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
5:40.369 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 13.0/100: 13% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:41.114 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 19.0/100: 19% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:42.357 thrash_bear Fluffy_Pillow 29692.4/32000: 93% mana | 19.0/100: 19% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:43.600 lacerate Fluffy_Pillow 30328.8/32000: 95% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:44.843 mangle Fluffy_Pillow 30965.2/32000: 97% mana | 29.0/100: 29% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:46.087 lacerate Fluffy_Pillow 31602.2/32000: 99% mana | 49.0/100: 49% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:47.330 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 57.0/100: 57% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, ursa_major, mark_of_bleeding_hollow
5:48.574 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 67.0/100: 67% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
5:49.274 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
5:49.818 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
5:51.060 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
5:52.302 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 52.0/100: 52% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, ursa_major, mark_of_bleeding_hollow
5:53.402 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:53.547 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:54.788 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/100: 3% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:56.033 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:57.279 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 42.0/100: 42% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:58.523 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 48.0/100: 48% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, ursa_major, mark_of_bleeding_hollow
5:59.765 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 56.0/100: 56% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
6:00.065 maul Fluffy_Pillow 32000.0/32000: 100% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:00.265 barkskin Fluffy_Pillow 32000.0/32000: 100% mana | 46.0/100: 46% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:01.009 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 47.0/100: 47% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:02.254 use_item_sanctus_sigil_of_the_unbroken Fluffy_Pillow 32000.0/32000: 100% mana | 52.0/100: 52% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, mark_of_bleeding_hollow
6:02.254 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 52.0/100: 52% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, sanctus, mark_of_bleeding_hollow
6:03.497 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 63.0/100: 63% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, sanctus, mark_of_bleeding_hollow
6:03.497 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, ursa_major, sanctus, mark_of_bleeding_hollow
6:04.741 use_item_mirror_of_the_blademaster Fluffy_Pillow 32000.0/32000: 100% mana | 40.0/100: 40% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw(2), ursa_major, sanctus, mark_of_bleeding_hollow
6:04.741 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 40.0/100: 40% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw(2), ursa_major, sanctus, mark_of_bleeding_hollow
6:05.985 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 55.0/100: 55% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw(3), ursa_major, sanctus, mark_of_bleeding_hollow
6:06.085 maul Fluffy_Pillow 32000.0/32000: 100% mana | 37.0/100: 37% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, sanctus, mark_of_bleeding_hollow
6:07.228 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 38.0/100: 38% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, sanctus, mark_of_bleeding_hollow
6:08.473 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 66.0/100: 66% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw(2), ursa_major, sanctus
6:09.717 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 69.0/100: 69% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw(2), ursa_major, sanctus
6:10.961 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 77.0/100: 77% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw(2), ursa_major, sanctus
6:10.961 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 27.0/100: 27% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw(2), ursa_major, sanctus
6:12.061 maul Fluffy_Pillow 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
6:12.206 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
6:13.451 pulverize Fluffy_Pillow 29693.4/32000: 93% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward, dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
6:14.551 maul Fluffy_Pillow 30256.6/32000: 95% mana | 6.0/100: 6% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
6:14.694 skull_bash Fluffy_Pillow 30329.9/32000: 95% mana | 7.0/100: 7% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
6:14.694 berserk Fluffy_Pillow 30329.9/32000: 95% mana | 7.0/100: 7% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
6:14.694 lacerate Fluffy_Pillow 30329.9/32000: 95% mana | 7.0/100: 7% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
6:15.938 mangle Fluffy_Pillow 30966.8/32000: 97% mana | 17.0/100: 17% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, sanctus
6:17.038 maul Fluffy_Pillow 31530.0/32000: 99% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
6:17.183 thrash_bear Fluffy_Pillow 31604.2/32000: 99% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, sanctus
6:18.426 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:19.670 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 40.0/100: 40% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:19.670 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/100: 3% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:20.912 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 16.0/100: 16% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
6:20.912 maul Fluffy_Pillow 32000.0/32000: 100% mana | 19.0/100: 19% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
6:22.158 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
6:23.402 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 57.0/100: 57% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:23.402 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 20.0/100: 20% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:24.202 maul Fluffy_Pillow 32000.0/32000: 100% mana | 8.0/100: 8% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major
6:24.647 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 13.0/100: 13% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:25.887 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 29.0/100: 29% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:26.687 maul Fluffy_Pillow 32000.0/32000: 100% mana | 45.0/100: 45% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:27.130 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 45.0/100: 45% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:28.372 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 61.0/100: 61% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:28.472 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 51.0/100: 51% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:29.614 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 52.0/100: 52% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points berserk, dream_of_cenarius, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:30.214 maul Fluffy_Pillow 32000.0/32000: 100% mana | 55.0/100: 55% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:30.859 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 68.0/100: 68% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:31.759 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 11.0/100: 11% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:32.103 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 11.0/100: 11% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:33.348 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 19.0/100: 19% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw(3), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:34.592 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 21.0/100: 21% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, savage_defense, tooth_and_claw(3), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:35.834 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 26.0/100: 26% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw(3), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:37.079 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 41.0/100: 41% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
6:38.079 maul Fluffy_Pillow 32000.0/32000: 100% mana | 22.0/100: 22% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:38.323 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 22.0/100: 22% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:39.568 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 43.0/100: 43% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:40.810 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 53.0/100: 53% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), ursa_major, mark_of_bleeding_hollow
6:42.054 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 69.0/100: 69% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
6:42.954 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(3), ursa_major, mark_of_bleeding_hollow
6:43.298 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 25.0/100: 25% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(3), ursa_major
6:44.098 maul Fluffy_Pillow 29465.6/32000: 92% mana | 13.0/100: 13% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:44.541 pulverize Fluffy_Pillow 29692.4/32000: 93% mana | 13.0/100: 13% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:45.786 lacerate Fluffy_Pillow 30329.9/32000: 95% mana | 27.0/100: 27% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:47.029 mangle Fluffy_Pillow 30966.3/32000: 97% mana | 42.0/100: 42% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(3), ursa_major
6:47.029 savage_defense Fluffy_Pillow 30966.3/32000: 97% mana | 5.0/100: 5% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), ursa_major
6:48.271 lacerate Fluffy_Pillow 31602.2/32000: 99% mana | 6.0/100: 6% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), ursa_major
6:49.515 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 22.0/100: 22% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), ursa_major
6:50.758 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 45.0/100: 45% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), ursa_major
6:52.001 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 60.0/100: 60% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), ursa_major
6:52.001 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 60.0/100: 60% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(3), ursa_major
6:53.201 maul Fluffy_Pillow 32000.0/32000: 100% mana | 59.0/100: 59% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:53.245 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 72.0/100: 72% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:54.490 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 74.0/100: 74% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:54.490 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 37.0/100: 37% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:55.732 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 43.0/100: 43% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw(2), tooth_and_claw_absorb, ursa_major
6:56.232 maul Fluffy_Pillow 32000.0/32000: 100% mana | 39.0/100: 39% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:56.974 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 39.0/100: 39% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
6:58.218 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 47.0/100: 47% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:59.418 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/100: 3% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
6:59.462 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/100: 3% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:00.362 barkskin Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:00.706 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:01.950 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 34.0/100: 34% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:03.193 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 58.0/100: 58% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:04.436 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 65.0/100: 65% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, savage_defense, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:05.680 use_item_mirror_of_the_blademaster Fluffy_Pillow 32000.0/32000: 100% mana | 72.0/100: 72% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:05.680 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 72.0/100: 72% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:06.180 maul Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:06.924 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:07.724 frenzied_regeneration Thornpaw 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, primal_tenacity, pulverize, tooth_and_claw_absorb, ursa_major, mark_of_bleeding_hollow
7:08.168 pulverize Fluffy_Pillow 32000.0/32000: 100% mana | 23.0/100: 23% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major, mark_of_bleeding_hollow
7:09.409 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 24.0/100: 24% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major, mark_of_bleeding_hollow
7:10.653 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 31.0/100: 31% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major
7:11.897 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 68.0/100: 68% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, barkskin, pulverize, ursa_major
7:12.397 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 10.0/100: 10% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major
7:13.141 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 11.0/100: 11% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, ursa_major
7:14.385 cenarion_ward Fluffy_Pillow 32000.0/32000: 100% mana | 18.0/100: 18% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
7:15.628 mangle Fluffy_Pillow 29692.4/32000: 93% mana | 19.0/100: 19% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw, ursa_major
7:16.869 lacerate Fluffy_Pillow 30327.8/32000: 95% mana | 39.0/100: 39% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points cenarion_ward, dream_of_cenarius, pulverize, savage_defense, tooth_and_claw(2), ursa_major
7:18.069 maul Fluffy_Pillow 30942.2/32000: 97% mana | 35.0/100: 35% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
7:18.112 lacerate Fluffy_Pillow 30964.2/32000: 97% mana | 35.0/100: 35% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
7:19.355 pulverize Fluffy_Pillow 31600.6/32000: 99% mana | 38.0/100: 38% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
7:20.598 lacerate Fluffy_Pillow 32000.0/32000: 100% mana | 43.0/100: 43% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
7:21.842 mangle Fluffy_Pillow 32000.0/32000: 100% mana | 54.0/100: 54% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, tooth_and_claw, tooth_and_claw_absorb, ursa_major
7:21.842 savage_defense Fluffy_Pillow 32000.0/32000: 100% mana | 9.0/100: 9% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major
7:23.084 thrash_bear Fluffy_Pillow 32000.0/32000: 100% mana | 15.0/100: 15% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points dream_of_cenarius, primal_tenacity, pulverize, savage_defense, tooth_and_claw, tooth_and_claw_absorb, ursa_major

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 653 622 622
Agility 6623 6058 6058 (3296)
Stamina 10898 7621 7303
Intellect 1094 1042 1042
Spirit 782 782 782
Health 653880 457260 0
Mana 32000 32000 0
Rage 100 100 0
Energy 100 100 0
Combo Points 5 5 0
Spell Power 1203 1042 0
Crit 29.89% 24.89% 1088
Haste 21.04% 15.27% 1272
Multistrike 21.18% 16.18% 1068
Damage / Heal Versatility 4.19% 1.19% 155
Mitigation Versatility 2.10% 0.60% 155
ManaReg per Second 512 512 0
Attack Power 10304 8196 0
Mastery 50.88% 41.21% 2142
Armor 5777 1776 1404
Bonus Armor 372 372 372
Run Speed 0 0 165
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 26.28% 24.31% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 732.00
Local Head Oathclaw Helm
ilevel: 735, stats: { 190 Armor, +444 AgiInt, +667 Sta, +359 Mastery, +232 Crit }
Local Neck Chain of Lidless Eyes
ilevel: 740, stats: { +262 Agi, +393 Sta, +242 Haste, +107 Mastery }, enchant: { +75 Crit }
Local Shoulders Oathclaw Mantle
ilevel: 720, stats: { 161 Armor, +290 AgiInt, +435 Sta, +251 Mastery, +135 Haste, +165 RunSpeed }
Local Chest Oathclaw Vestment
ilevel: 720, stats: { 215 Armor, +387 AgiInt, +580 Sta, +323 Haste, +191 Mastery }
Local Waist Waistwrap of Banishment
ilevel: 745, stats: { 139 Armor, +366 AgiInt, +548 Sta, +327 Mult, +160 Mastery }
Local Legs Oathclaw Leggings
ilevel: 735, stats: { 205 Armor, +444 AgiInt, +667 Sta, +346 Mult, +245 Mastery }
Local Feet Oppressor's Merciless Treads
ilevel: 731, stats: { 157 Armor, +321 AgiInt, +482 Sta, +269 Haste, +159 Crit }
Local Wrists Manacles of the Multitudes
ilevel: 740, stats: { 105 Armor, +262 AgiInt, +393 Sta, +234 Crit, +115 Mastery }
Local Hands Felfinger Runegloves
ilevel: 730, stats: { 142 Armor, +318 AgiInt, +477 Sta, +303 Haste, +121 Mastery }, gems: { +50 Mastery }
Local Finger1 Sanctus, Sigil of the Unbroken
ilevel: 738, stats: { +257 StrAgi, +386 Sta, +181 BonusArmor, +155 Vers }
Local Finger2 Mannoroth's Calcified Eye
ilevel: 715, stats: { +207 StrAgi, +311 Sta, +191 BonusArmor, +85 Mastery }
Local Trinket1 Mirror of the Blademaster
ilevel: 730, stats: { +525 Agi }, gems: { +50 Mastery }
Local Trinket2 Seed of Creation
ilevel: 736
Local Back Windswept Wanderer's Drape
ilevel: 730, stats: { 90 Armor, +238 Agi, +357 Sta, +186 Mult, +131 Mastery }, enchant: { +100 Mastery }
Local Main Hand Rune Infused Spear
ilevel: 736, weapon: { 2321 - 3483, 3.6 }, stats: { +449 Agi, +673 Sta, +388 Crit, +209 Mult }, gems: { +75 Mastery }, enchant: mark_of_bleeding_hollow

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Guardian Druid) Mass Entanglement Typhoon
60 Soul of the Forest (Guardian Druid) Incarnation: Son of Ursoc (Guardian Druid) Force of Nature (Guardian Druid)
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild (Guardian Druid) Dream of Cenarius (Guardian Druid) Nature's Vigil
100 Guardian of Elune (Guardian Druid) Pulverize (Guardian Druid) Bristling Fur (Guardian Druid)

Profile

druid="Thornpaw"
origin="https://eu.api.battle.net/wow/character/arathor/Thornpaw/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hellfire/109/121295213-avatar.jpg"
level=100
race=night_elf
timeofday=night
role=tank
position=front
professions=engineering=700/leatherworking=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ub!2220111
glyphs=stampeding_roar/survival_instincts/faerie_fire/travel/grace/aquatic_form
spec=guardian

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=sleeper_sushi
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/bear_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/cenarion_ward

# Executed every time the actor is available.

actions=auto_attack
actions+=/skull_bash
actions+=/savage_defense,if=buff.barkskin.down
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/use_item,slot=finger1
actions+=/use_item,slot=trinket1
actions+=/barkskin,if=buff.bristling_fur.down
actions+=/bristling_fur,if=buff.barkskin.down&buff.savage_defense.down
actions+=/maul,if=buff.tooth_and_claw.react&incoming_damage_1s
actions+=/berserk,if=(buff.pulverize.remains>10|!talent.pulverize.enabled)&buff.incarnation.down
actions+=/frenzied_regeneration,if=rage>=80
actions+=/cenarion_ward
actions+=/renewal,if=health.pct<30
actions+=/heart_of_the_wild
actions+=/rejuvenation,if=buff.heart_of_the_wild.up&remains<=3.6
actions+=/natures_vigil
actions+=/healing_touch,if=buff.dream_of_cenarius.react&health.pct<30
actions+=/pulverize,if=buff.pulverize.remains<=3.6
actions+=/lacerate,if=talent.pulverize.enabled&buff.pulverize.remains<=(3-dot.lacerate.stack)*gcd&buff.berserk.down
actions+=/incarnation,if=buff.berserk.down
actions+=/lacerate,if=!ticking
actions+=/thrash_bear,if=!ticking
actions+=/mangle
actions+=/thrash_bear,if=remains<=4.8
actions+=/lacerate

head=oathclaw_helm,id=124261,bonus_id=567,upgrade=2
neck=chain_of_lidless_eyes,id=124209,bonus_id=567,upgrade=2,enchant=75crit
shoulders=oathclaw_mantle,id=124272,bonus_id=42/566,upgrade=2
back=windswept_wanderers_drape,id=124133,bonus_id=567,upgrade=2,enchant=gift_of_mastery
chest=oathclaw_vestment,id=124246,bonus_id=566,upgrade=2
wrists=manacles_of_the_multitudes,id=124280,bonus_id=567,upgrade=2
hands=felfinger_runegloves,id=124254,bonus_id=564/566,upgrade=2,gems=50mastery
waist=waistwrap_of_banishment,id=124276,bonus_id=567,upgrade=2,addon=nitro_boosts
legs=oathclaw_leggings,id=124267,bonus_id=567,upgrade=2
feet=oppressors_merciless_treads,id=124251,bonus_id=561/566,upgrade=2
finger1=sanctus_sigil_of_the_unbroken,id=124637,bonus_id=622/649
finger2=mannoroths_calcified_eye,id=124204,bonus_id=566
trinket1=mirror_of_the_blademaster,id=124224,bonus_id=565/567,upgrade=2,gems=50mastery
trinket2=seed_of_creation,id=124514,bonus_id=561/566,upgrade=2
main_hand=rune_infused_spear,id=124377,bonus_id=562/565/567,upgrade=2,gems=75mastery,enchant=mark_of_bleeding_hollow

# Gear Summary
# gear_ilvl=732.07
# gear_agility=4770
# gear_stamina=6369
# gear_crit_rating=1088
# gear_haste_rating=1272
# gear_mastery_rating=2040
# gear_multistrike_rating=1068
# gear_versatility_rating=155
# gear_speed_rating=165
# gear_armor=1404
# gear_bonus_armor=372
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1

Nightkillerr

Nightkillerr : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
993.2 993.2 Mana 53.60% 18.3 100.0% 100%
Origin https://eu.api.battle.net/wow/character/arathor/Nightkillerr/advanced
Talents
  • 15: Displacer Beast
  • 30: Ysera's Gift
  • 45: Typhoon
  • 60: Incarnation: Tree of Life (Restoration Druid)
  • 75: Ursol's Vortex
  • 90: Heart of the Wild (Restoration Druid)
  • 100: Germination (Restoration Druid)
  • Talent Calculator
Glyphs
  • Glyph of Rejuvenation
  • Glyph of Regrowth
  • Glyph of Wild Growth
  • Glyph of the Sprouting Mushroom
  • Glyph of the Treant
Professions
  • tailoring: 700
  • enchanting: 700

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.03% 16.68% 0.0(0.0)

Buff details

  • buff initial source:Nightkillerr
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Draenic Intellect Potion 1.0 0.0 0.0sec 0.0sec 5.19% 5.21% 0.0(0.0)

Buff details

  • buff initial source:Nightkillerr
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your Intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Harmony 1.0 101.3 0.0sec 4.4sec 99.51% 99.70% 101.3(101.3)

Buff details

  • buff initial source:Nightkillerr
  • cooldown name:buff_harmony
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • harmony_1:99.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:100977
  • name:Harmony
  • tooltip:Periodic healing increased by $w1%.
  • description:Casting your direct healing spells grants you a {$77495s1=0}% bonus to periodic healing for {$100977d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of Shadowmoon 10.1 0.0 41.7sec 41.7sec 33.20% 33.21% 0.0(0.0)

Buff details

  • buff initial source:Nightkillerr
  • cooldown name:buff_mark_of_shadowmoon
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:spirit
  • amount:500.00

Stack Uptimes

  • mark_of_shadowmoon_1:33.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159678
  • name:Mark of Shadowmoon
  • tooltip:Spirit increased by $w1.
  • description:Increases Spirit by {$s1=500}.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Clearcasting (omen_of_clarity) 11.3 14.4 39.9sec 17.0sec 57.28% 57.29% 14.4(14.4)

Buff details

  • buff initial source:Nightkillerr
  • cooldown name:buff_omen_of_clarity
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:4.00%
  • default_value:-0.00

Stack Uptimes

  • omen_of_clarity_1:57.28%

Trigger Attempt Success

  • trigger_pct:4.01%

Spelldata details

  • id:16870
  • name:Clearcasting
  • tooltip:Your next Regrowth is free.
  • description:{$@spelldesc113043=Your periodic healing from Lifebloom has a {$h=4}% chance to cause you to enter a Clearcasting state, causing your next Regrowth to be free.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
buttered_sturgeon_food

Buff details

  • buff initial source:Nightkillerr
  • cooldown name:buff_buttered_sturgeon_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:125.00

Stack Uptimes

  • buttered_sturgeon_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Stance of the Fierce Tiger (fierce_tiger_movement_aura)

Buff details

  • buff initial source:Nightkillerr
  • cooldown name:buff_fierce_tiger_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fierce_tiger_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:
  • description:Increases all damage dealt by {$s3=10}%. Grants you and your allies within $m7 yards {$166646s1=10}% increased movement speed, and improves the functionality of Jab, Expel Harm, Tiger Palm, Blackout Kick, and Rising Sun Kick.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Draenic Intellect Flask

Buff details

  • buff initial source:Nightkillerr
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Nightkillerr
healing_touch Mana 98.3 325447.7 3312.0 3312.0 0.0
lifebloom Mana 1.0 1440.0 1440.0 1440.0 0.0
rejuvenation Mana 33.8 102035.7 3023.0 3023.0 0.0
swiftmend Mana 4.0 16728.2 4160.0 4160.2 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 2647.77 0.00 (0.00%) 0.00 6401.97 100.00%
mp5_regen Mana 2647.77 288006.99 (100.00%) 108.77 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 640.00 993.22
Combat End Resource Mean Min Max
Mana 1023.99 0.00 3075.88
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Nightkillerr Fight Length
Count 24999
Mean 450.01
Minimum 351.82
Maximum 558.10
Spread ( max - min ) 206.27
Range [ ( max - min ) / 2 * 100% ] 22.92%
DPS
Sample Data Nightkillerr Damage Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Nightkillerr Priority Target Damage Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Nightkillerr Damage Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Nightkillerr Damage
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Nightkillerr Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Nightkillerr Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Nightkillerr Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Nightkillerr Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Nightkillerr Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Nightkillerr Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data NightkillerrTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Nightkillerr Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=buttered_sturgeon
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_intellect
Default action list Executed every time the actor is available.
# count action,conditions
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent
5 60.19 healing_touch,if=buff.natures_swiftness.up|buff.omen_of_clarity.up
6 33.75 rejuvenation,if=remains<=duration*0.3
7 1.00 lifebloom,if=debuff.lifebloom.down
8 4.02 swiftmend
9 38.30 healing_touch

Sample Sequence

0146789555555555568999995555555555555555555555555689955555555555555685556969965655656596565569655696996965569699696996969969699696556565569

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points draenic_intellect_potion
0:00.000 rejuvenation Healing_Target 160000.0/160000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points draenic_intellect_potion
0:01.086 lifebloom Healing_Target 157672.0/160000: 99% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, draenic_intellect_potion
0:02.089 swiftmend Healing_Target 156874.0/160000: 98% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, draenic_intellect_potion
0:03.094 healing_touch Healing_Target 153357.2/160000: 96% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, harmony, draenic_intellect_potion
0:04.485 healing_touch Healing_Target 150935.4/160000: 94% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony, draenic_intellect_potion
0:05.879 healing_touch Healing_Target 148515.6/160000: 93% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony, draenic_intellect_potion
0:07.271 healing_touch Healing_Target 146094.4/160000: 91% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony, draenic_intellect_potion
0:08.664 healing_touch Healing_Target 143674.0/160000: 90% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony, draenic_intellect_potion
0:10.057 healing_touch Healing_Target 141253.5/160000: 88% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony, draenic_intellect_potion
0:11.450 healing_touch Healing_Target 138833.0/160000: 87% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony, draenic_intellect_potion
0:12.844 healing_touch Healing_Target 136413.2/160000: 85% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony, draenic_intellect_potion
0:14.238 healing_touch Healing_Target 133993.3/160000: 84% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony, draenic_intellect_potion
0:15.630 healing_touch Healing_Target 131572.2/160000: 82% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony, draenic_intellect_potion
0:17.023 healing_touch Healing_Target 129151.7/160000: 81% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony, draenic_intellect_potion
0:18.416 rejuvenation Healing_Target 126731.2/160000: 79% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, harmony, draenic_intellect_potion
0:19.420 swiftmend Healing_Target 124350.8/160000: 78% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, harmony, draenic_intellect_potion
0:20.425 healing_touch Healing_Target 120834.0/160000: 76% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, harmony, draenic_intellect_potion
0:21.817 healing_touch Healing_Target 118412.9/160000: 74% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, harmony, draenic_intellect_potion
0:23.209 healing_touch Healing_Target 115991.8/160000: 72% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, harmony
0:24.601 healing_touch Healing_Target 113570.6/160000: 71% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, harmony
0:25.994 healing_touch Healing_Target 111150.2/160000: 69% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, harmony
0:27.388 healing_touch Healing_Target 108730.3/160000: 68% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony
0:28.781 healing_touch Healing_Target 106309.8/160000: 66% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony
0:30.174 healing_touch Healing_Target 103889.4/160000: 65% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony
0:31.566 healing_touch Healing_Target 101468.2/160000: 63% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony
0:32.959 healing_touch Healing_Target 99047.8/160000: 62% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony
0:34.351 healing_touch Healing_Target 96626.6/160000: 60% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony
0:35.743 healing_touch Healing_Target 94205.5/160000: 59% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony
0:37.136 healing_touch Healing_Target 91785.0/160000: 57% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony
0:38.528 healing_touch Healing_Target 89363.9/160000: 56% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony
0:39.920 healing_touch Healing_Target 86942.8/160000: 54% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, harmony
0:41.313 healing_touch Healing_Target 84522.3/160000: 53% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
0:43.121 healing_touch Healing_Target 82367.4/160000: 51% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
0:44.931 healing_touch Healing_Target 80213.8/160000: 50% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
0:46.738 healing_touch Healing_Target 78058.3/160000: 49% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
0:48.548 healing_touch Healing_Target 75904.7/160000: 47% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
0:50.357 healing_touch Healing_Target 73750.5/160000: 46% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
0:52.166 healing_touch Healing_Target 71596.2/160000: 45% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
0:53.974 healing_touch Healing_Target 69441.4/160000: 43% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
0:55.783 healing_touch Healing_Target 67287.1/160000: 42% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
0:57.591 healing_touch Healing_Target 65132.2/160000: 41% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
0:59.400 healing_touch Healing_Target 62978.0/160000: 39% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
1:01.209 healing_touch Healing_Target 60823.8/160000: 38% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
1:03.019 healing_touch Healing_Target 58670.2/160000: 37% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:04.827 healing_touch Healing_Target 56515.3/160000: 35% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:06.637 healing_touch Healing_Target 54361.7/160000: 34% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:08.444 rejuvenation Healing_Target 52206.2/160000: 33% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
1:09.530 swiftmend Healing_Target 49878.2/160000: 31% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
1:10.617 healing_touch Healing_Target 46413.9/160000: 29% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
1:12.426 healing_touch Healing_Target 44259.6/160000: 28% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
1:14.234 healing_touch Healing_Target 42104.8/160000: 26% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:16.041 healing_touch Healing_Target 39949.2/160000: 25% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:17.848 healing_touch Healing_Target 37793.7/160000: 24% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:19.657 healing_touch Healing_Target 35639.5/160000: 22% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:21.466 healing_touch Healing_Target 33485.2/160000: 21% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:23.272 healing_touch Healing_Target 31329.1/160000: 20% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:25.080 healing_touch Healing_Target 29174.2/160000: 18% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:26.888 healing_touch Healing_Target 27019.3/160000: 17% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:28.696 healing_touch Healing_Target 24864.4/160000: 16% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
1:30.503 healing_touch Healing_Target 22708.9/160000: 14% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
1:32.311 healing_touch Healing_Target 20554.0/160000: 13% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
1:34.118 healing_touch Healing_Target 18398.5/160000: 11% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
1:35.926 healing_touch Healing_Target 16243.6/160000: 10% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
1:37.735 healing_touch Healing_Target 14089.4/160000: 9% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
1:39.544 rejuvenation Healing_Target 11935.2/160000: 7% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
1:40.630 swiftmend Healing_Target 9607.2/160000: 6% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
1:41.717 healing_touch Healing_Target 6142.9/160000: 4% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
1:43.526 healing_touch Healing_Target 3988.6/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:45.335 Waiting 2.400 sec 1834.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:47.735 healing_touch Healing_Target 3370.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:49.543 Waiting 2.900 sec 1215.5/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:52.443 rejuvenation Healing_Target 3071.5/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:53.530 Waiting 4.100 sec 744.2/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
1:57.630 healing_touch Healing_Target 3368.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
1:59.438 Waiting 2.900 sec 1213.3/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
2:02.338 rejuvenation Healing_Target 3069.3/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
2:03.423 Waiting 4.100 sec 740.7/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
2:07.523 healing_touch Healing_Target 3364.7/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
2:09.332 Waiting 3.300 sec 1210.5/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
2:12.632 healing_touch Healing_Target 3322.5/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
2:14.440 Waiting 2.900 sec 1167.6/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
2:17.340 rejuvenation Healing_Target 3023.6/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
2:18.427 Waiting 4.100 sec 696.3/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
2:22.527 healing_touch Healing_Target 3320.3/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
2:24.335 Waiting 3.000 sec 1165.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:27.335 rejuvenation Healing_Target 3085.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:28.422 Waiting 4.000 sec 758.1/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:32.422 healing_touch Healing_Target 3318.1/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:34.230 Waiting 3.400 sec 1163.2/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:37.630 healing_touch Healing_Target 3339.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:39.441 Waiting 2.900 sec 1186.2/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:42.341 rejuvenation Healing_Target 3042.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:43.425 Waiting 4.100 sec 713.0/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:47.525 healing_touch Healing_Target 3337.0/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:49.335 Waiting 2.900 sec 1183.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
2:52.235 rejuvenation Healing_Target 3039.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
2:53.322 Waiting 4.100 sec 712.1/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
2:57.422 healing_touch Healing_Target 3336.1/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
2:59.231 Waiting 3.400 sec 1181.8/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
3:02.631 healing_touch Healing_Target 3357.8/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
3:04.438 Waiting 2.900 sec 1202.3/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
3:07.338 rejuvenation Healing_Target 3058.3/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:08.424 Waiting 4.100 sec 730.4/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:12.524 healing_touch Healing_Target 3354.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:14.332 Waiting 2.900 sec 1199.5/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:17.232 rejuvenation Healing_Target 3055.5/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:18.319 Waiting 4.100 sec 728.2/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:22.419 healing_touch Healing_Target 3352.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:24.228 Waiting 3.400 sec 1197.9/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:27.628 healing_touch Healing_Target 3373.9/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:29.435 Waiting 2.900 sec 1218.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:32.335 rejuvenation Healing_Target 3074.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
3:33.421 Waiting 4.100 sec 746.4/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
3:37.521 healing_touch Healing_Target 3370.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
3:39.330 Waiting 2.900 sec 1216.2/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
3:42.230 rejuvenation Healing_Target 3072.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
3:43.316 Waiting 4.100 sec 744.2/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
3:47.416 healing_touch Healing_Target 3368.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:49.224 Waiting 3.300 sec 1213.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:52.524 healing_touch Healing_Target 3325.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:54.331 Waiting 2.900 sec 1169.8/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:57.231 rejuvenation Healing_Target 3025.8/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
3:58.317 Waiting 4.100 sec 697.9/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
4:02.417 healing_touch Healing_Target 3321.9/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
4:04.226 Waiting 2.900 sec 1167.6/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
4:07.126 rejuvenation Healing_Target 3023.6/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
4:08.211 Waiting 4.100 sec 695.0/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
4:12.311 healing_touch Healing_Target 3319.0/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
4:14.121 Waiting 3.400 sec 1165.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
4:17.521 healing_touch Healing_Target 3341.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
4:19.329 Waiting 2.900 sec 1186.6/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
4:22.229 rejuvenation Healing_Target 3042.6/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
4:23.316 Waiting 4.100 sec 715.2/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
4:27.416 healing_touch Healing_Target 3339.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
4:29.225 Waiting 2.900 sec 1185.0/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
4:32.125 rejuvenation Healing_Target 3041.0/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
4:33.211 Waiting 4.100 sec 713.0/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
4:37.311 healing_touch Healing_Target 3337.0/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
4:39.119 Waiting 3.400 sec 1182.2/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
4:42.519 healing_touch Healing_Target 3358.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
4:44.328 Waiting 2.900 sec 1203.9/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
4:47.228 rejuvenation Healing_Target 3059.9/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
4:48.315 Waiting 4.100 sec 732.6/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
4:52.415 healing_touch Healing_Target 3356.6/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
4:54.224 Waiting 2.900 sec 1202.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
4:57.124 rejuvenation Healing_Target 3058.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
4:58.212 Waiting 4.100 sec 731.7/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:02.312 healing_touch Healing_Target 3355.7/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:04.121 Waiting 3.300 sec 1201.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:07.421 healing_touch Healing_Target 3313.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:09.230 Waiting 3.000 sec 1159.2/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:12.230 rejuvenation Healing_Target 3079.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:13.316 Waiting 4.100 sec 751.2/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:17.416 healing_touch Healing_Target 3375.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:19.224 Waiting 2.900 sec 1220.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:22.124 rejuvenation Healing_Target 3076.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:23.212 Waiting 4.100 sec 749.7/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:27.312 healing_touch Healing_Target 3373.7/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:29.122 Waiting 3.300 sec 1220.1/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:32.422 healing_touch Healing_Target 3332.1/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:34.229 Waiting 2.900 sec 1176.6/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:37.129 rejuvenation Healing_Target 3032.6/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:38.215 Waiting 4.100 sec 704.6/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:42.315 healing_touch Healing_Target 3328.6/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:44.123 Waiting 2.900 sec 1173.7/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:47.023 rejuvenation Healing_Target 3029.7/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:48.109 Waiting 4.100 sec 701.8/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
5:52.209 healing_touch Healing_Target 3325.8/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:54.017 Waiting 3.400 sec 1170.9/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:57.417 healing_touch Healing_Target 3346.9/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
5:59.226 Waiting 2.900 sec 1192.6/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
6:02.126 rejuvenation Healing_Target 3048.6/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
6:03.214 Waiting 4.100 sec 722.0/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
6:07.314 healing_touch Healing_Target 3346.0/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
6:09.123 Waiting 2.900 sec 1191.7/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
6:12.023 rejuvenation Healing_Target 3047.7/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
6:13.108 Waiting 4.100 sec 719.1/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
6:17.208 healing_touch Healing_Target 3343.1/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
6:19.018 Waiting 3.400 sec 1189.5/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
6:22.418 healing_touch Healing_Target 3365.5/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
6:24.228 Waiting 2.900 sec 1211.9/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
6:27.128 rejuvenation Healing_Target 3067.9/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
6:28.216 Waiting 4.100 sec 741.2/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony, mark_of_shadowmoon
6:32.316 healing_touch Healing_Target 3365.2/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
6:34.124 Waiting 2.900 sec 1210.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
6:37.024 rejuvenation Healing_Target 3066.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
6:38.111 Waiting 4.100 sec 739.0/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
6:42.211 healing_touch Healing_Target 3363.0/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
6:44.018 Waiting 3.300 sec 1207.5/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
6:47.318 healing_touch Healing_Target 3319.5/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
6:49.126 Waiting 3.000 sec 1164.6/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
6:52.126 rejuvenation Healing_Target 3084.6/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
6:53.211 Waiting 4.000 sec 756.0/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
6:57.211 healing_touch Healing_Target 3316.0/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
6:59.020 Waiting 3.000 sec 1161.8/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
7:02.020 rejuvenation Healing_Target 3081.8/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
7:03.107 Waiting 4.000 sec 754.5/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
7:07.107 healing_touch Healing_Target 3314.5/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
7:08.914 Waiting 3.400 sec 1159.0/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony, mark_of_shadowmoon
7:12.314 healing_touch Healing_Target 3335.0/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
7:14.121 Waiting 2.900 sec 1179.4/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
7:17.021 rejuvenation Healing_Target 3035.4/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
7:18.107 Waiting 4.100 sec 707.5/160000: 0% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points omen_of_clarity, harmony
7:22.207 healing_touch Healing_Target 3331.5/160000: 2% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony
7:24.015 Waiting 0.300 sec 1176.6/160000: 1% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points harmony

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 653 622 622
Agility 1352 1288 1288
Stamina 8028 7299 7299
Intellect 6530 5956 5725 (4631)
Spirit 1714 1714 1714 (932)
Health 481680 437940 0
Mana 160000 160000 0
Rage 100 100 0
Energy 100 100 0
Combo Points 5 5 0
Spell Power 9854 8384 2428
Crit 14.45% 9.45% 489
Haste 38.52% 30.46% 2625
Multistrike 15.33% 10.33% 682
Damage / Heal Versatility 3.00% 0.00% 0
ManaReg per Second 640 640 0
Attack Power 1487 1288 0
Mastery 36.06% 29.81% 1743
Armor 1381 1381 1381

Gear

Source Slot Average Item Level: 732.00
Local Head Oathclaw Helm
ilevel: 735, stats: { 190 Armor, +444 AgiInt, +667 Sta, +359 Mastery, +232 Crit }
Local Neck Voltage Regulation Diode
ilevel: 736, stats: { +252 Int, +379 Sta, +197 Spi, +139 Haste }, enchant: { +75 Mastery }
Local Shoulders Oathclaw Mantle
ilevel: 726, stats: { 167 Armor, +307 AgiInt, +460 Sta, +265 Mastery, +143 Haste }
Local Chest Oathclaw Vestment
ilevel: 720, stats: { 215 Armor, +387 AgiInt, +580 Sta, +323 Haste, +191 Mastery }
Local Waist Girdle of Unconquered Glory
ilevel: 700, stats: { 108 Armor, +241 AgiInt, +361 Sta, +145 Haste, +170 Mult, +137 unknown }
Local Legs Oathclaw Leggings
ilevel: 735, stats: { 205 Armor, +444 AgiInt, +667 Sta, +346 Mult, +245 Mastery }
Local Feet Spiked Irontoe Slippers
ilevel: 730, stats: { 156 Armor, +318 AgiInt, +477 Sta, +257 Crit, +166 Mult }, gems: { +50 Haste }
Local Wrists Gorebound Wristguards
ilevel: 730, stats: { 99 Armor, +238 AgiInt, +357 Sta, +193 Mastery, +125 Haste }
Local Hands Felfinger Runegloves
ilevel: 736, stats: { 147 Armor, +337 AgiInt, +505 Sta, +320 Haste, +128 Mastery }
Local Finger1 Pompous Ceremonial Ring
ilevel: 735, stats: { +250 Int, +375 Sta, +230 Spi, +102 Mastery }, enchant: { +50 Haste }
Local Finger2 Etheralus, the Eternal Reward
ilevel: 780, stats: { +380 Int, +570 Sta, +279 Spi, +210 Haste }, enchant: { +50 Haste }
Local Trinket1 Seed of Creation
ilevel: 730
Local Trinket2 Demonic Phylactery
ilevel: 720, stats: { +359 Haste, +359 Int }
Local Back Drape of Beckoned Souls
ilevel: 735, stats: { 94 Armor, +250 Int, +375 Sta, +226 Spi, +107 Haste }, enchant: { +100 Haste }
Local Main Hand Edict of Argus
ilevel: 730, weapon: { 883 - 1326, 2.9 }, stats: { +424 Int, +636 Sta, +379 Haste, +185 Mastery, +2428 SP }, enchant: mark_of_shadowmoon

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm Mass Entanglement Typhoon
60 Soul of the Forest (Restoration Druid) Incarnation: Tree of Life (Restoration Druid) Force of Nature (Restoration Druid)
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild (Restoration Druid) Dream of Cenarius (Restoration Druid) Nature's Vigil
100 Moment of Clarity (Restoration Druid) Germination (Restoration Druid) Rampant Growth (Restoration Druid)

Profile

druid="Nightkillerr"
origin="https://eu.api.battle.net/wow/character/arathor/Nightkillerr/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hellfire/161/121255841-avatar.jpg"
level=100
race=night_elf
timeofday=night
role=heal
position=back
professions=tailoring=700/enchanting=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#UY!1021101
glyphs=rejuvenation/regrowth/wild_growth/sprouting_mushroom/treant
spec=restoration

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=buttered_sturgeon
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect

# Executed every time the actor is available.

actions=blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/healing_touch,if=buff.natures_swiftness.up|buff.omen_of_clarity.up
actions+=/rejuvenation,if=remains<=duration*0.3
actions+=/lifebloom,if=debuff.lifebloom.down
actions+=/swiftmend
actions+=/healing_touch

head=oathclaw_helm,id=124261,bonus_id=567,upgrade=2
neck=voltage_regulation_diode,id=124213,bonus_id=562/567,upgrade=2,enchant=75mastery
shoulders=oathclaw_mantle,id=124272,bonus_id=561/566,upgrade=2
back=drape_of_beckoned_souls,id=124141,bonus_id=567,upgrade=2,enchant=gift_of_haste
chest=oathclaw_vestment,id=124246,bonus_id=566,upgrade=2
wrists=gorebound_wristguards,id=124278,bonus_id=567,upgrade=2
hands=felfinger_runegloves,id=124254,bonus_id=561/566,upgrade=2
waist=girdle_of_unconquered_glory,id=113907,bonus_id=43/567
legs=oathclaw_leggings,id=124267,bonus_id=567,upgrade=2
feet=spiked_irontoe_slippers,id=124249,bonus_id=565/567,upgrade=2,gems=50haste
finger1=pompous_ceremonial_ring,id=124195,bonus_id=567,upgrade=1,enchant=50haste
finger2=etheralus_the_eternal_reward,id=124638,bonus_id=636/649,enchant=50haste
trinket1=seed_of_creation,id=124514,bonus_id=566,upgrade=2
trinket2=demonic_phylactery,id=124233,bonus_id=566,upgrade=2
main_hand=edict_of_argus,id=124382,bonus_id=566,upgrade=2,enchant=mark_of_shadowmoon

# Gear Summary
# gear_ilvl=731.87
# gear_stamina=6409
# gear_intellect=4631
# gear_spirit=932
# gear_spell_power=2428
# gear_crit_rating=489
# gear_haste_rating=2500
# gear_mastery_rating=1743
# gear_multistrike_rating=682
# gear_armor=1381
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1

Mokillr

Mokillr : 100021 dps, 100021 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
100021.2 100021.2 44.9 / 0.045% 14152.4 / 14.1% 6820.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.1 13.1 Focus 0.00% 45.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/arathor/Mokillr/advanced
Talents
  • 15: Crouching Tiger, Hidden Chimaera
  • 30: Binding Shot
  • 45: Iron Hawk
  • 60: Thrill of the Hunt
  • 75: Stampede
  • 90: Barrage
  • 100: Lone Wolf
  • Talent Calculator
Glyphs
  • Glyph of Pathfinding
  • Glyph of Deterrence
  • Glyph of Disengage
  • Glyph of Play Dead
  • Glyph of Stampede
  • Glyph of Aspect of the Cheetah
Professions
  • alchemy: 700
  • engineering: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% M-Count M-Hit M-Crit M-Crit% Up%
Mokillr 100021
Aimed Shot 27419 27.4% 89.5 4.99sec 137772 137155 Direct 89.5 46183 124627 114048 86.5% 0.0% 0.0% 62.3 13852 37394 86.5%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.53 89.46 0.00 0.00 1.0045 0.0000 12334101.12 18955565.93 34.93 137155.29 137155.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 53.87 86.51% 37394.32 29358 54380 37465.28 32347 44202 2014608 3096134 34.93
multistrike 8.40 13.49% 13852.10 13030 24135 13846.04 0 17573 116322 178768 34.92
hit 12.07 13.49% 46183.03 43434 80451 46171.36 43434 54792 557229 856374 34.93
crit 77.40 86.51% 124627.36 97861 181265 124884.65 113807 140819 9645942 14824290 34.93
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.focusing_shot.enabled
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals $sw2 Physical damage. Castable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
auto_shot 8026 8.0% 169.2 2.67sec 21318 8988 Direct 169.2 10692 24197 17639 51.4% 0.0% 0.0% 117.7 3207 7260 51.4%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 169.25 169.25 0.00 0.00 2.3719 0.0000 3607984.33 5544902.23 34.93 8987.63 8987.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 60.49 51.39% 7259.94 6175 11486 7264.23 6553 8311 439134 674880 34.93
multistrike 57.21 48.61% 3207.14 2741 5098 3208.80 2850 3683 183484 281986 34.93
hit 82.19 48.56% 10691.84 9136 16993 10697.24 9879 11748 878730 1350470 34.93
crit 87.06 51.44% 24196.79 20584 38288 24211.29 22372 26574 2106636 3237566 34.93
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 7346 7.3% 16.0 24.45sec 206559 70922 Periodic 252.6 6018 13561 9878 51.2% 0.0% 0.0% 176.3 2775 6252 51.2% 9.4%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.97 15.97 254.79 252.61 2.9125 0.1668 3298452.63 4637991.97 28.88 70922.26 70922.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 90.3 51.21% 6251.92 5900 9981 6251.39 5900 7042 564505 564505 0.00
multistrike 86.0 48.79% 2774.98 2619 4430 2774.74 2619 3215 238727 238727 0.00
hit 123.3 48.83% 6018.05 5680 9608 6017.52 5680 6835 742273 1140756 34.93
crit 129.3 51.17% 13560.66 12797 21648 13559.18 12797 15348 1752948 2694004 34.93
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
Chimaera Shot 0 (20151) 0.0% (20.2%) 45.1 10.09sec 200852 199953

Stats details: chimaera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.13 45.13 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 199953.49 199953.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.87 48.46% 0.00 0 0 0.00 0 0 0 0 0.00
crit 23.26 51.54% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: chimaera_shot

Static Values
  • id:53209
  • school:froststrike
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53209
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:A two-headed shot that hits your primary target and another nearby target, dealing $171454sw3 Nature or Frost damage to each target.
 
    Chimaera Shot (_frost) 10036 10.0% 0.0 0.00sec 0 0 Direct 22.5 100778 227276 165857 51.4% 0.0% 0.0% 15.6 30209 68194 51.4%  

Stats details: chimaera_shot_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 22.52 0.00 0.00 0.0000 0.0000 4512966.60 4512966.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.05 51.43% 68194.32 59557 110316 68166.47 0 110316 548774 548774 0.00
multistrike 7.60 48.57% 30209.25 26433 48961 30193.65 0 48961 229579 229579 0.00
hit 10.93 48.55% 100778.47 88111 163205 100808.65 88111 144909 1101811 1101811 0.00
crit 11.58 51.45% 227275.86 198524 367720 227384.35 198524 335831 2632803 2632803 0.00
 
 

Action details: chimaera_shot_frost

Static Values
  • id:171454
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171454
  • name:Chimaera Shot
  • school:frost
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171454sw3 Nature or Frost damage to each target.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.60
 
    Chimaera Shot (_nature) 10115 10.1% 0.0 0.00sec 0 0 Direct 22.5 101515 229033 167216 51.5% 0.0% 0.0% 15.7 30439 68702 51.5%  

Stats details: chimaera_shot_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 22.51 0.00 0.00 0.0000 0.0000 4550525.00 4550525.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.07 51.48% 68701.61 60008 111152 68711.29 0 111152 554446 554446 0.00
multistrike 7.61 48.52% 30439.10 26633 49332 30424.57 0 49332 231534 231534 0.00
hit 10.91 48.48% 101515.08 88778 164441 101562.18 88778 138876 1107930 1107930 0.00
crit 11.60 51.52% 229032.77 200028 370506 229143.78 200028 313539 2656615 2656615 0.00
 
 

Action details: chimaera_shot_nature

Static Values
  • id:171457
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171457
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171454sw3 Nature or Frost damage to each target.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.65
 
Kill Shot 9160 9.2% 27.1 5.73sec 151868 151192 Direct 27.0 76673 172812 126099 51.4% 0.0% 0.0% 18.8 23009 51844 51.3%  

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.09 26.99 0.00 0.00 1.0045 0.0000 4113782.14 6322233.61 34.93 151191.96 151191.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.63 51.28% 51843.64 46098 77980 51842.99 0 72051 499380 767468 34.93
multistrike 9.15 48.72% 23009.09 20460 34609 23017.10 0 34609 210592 323647 34.93
hit 13.12 48.59% 76673.41 68199 115365 76690.12 68199 96817 1005616 1545474 34.93
crit 13.88 51.41% 172812.15 153660 259932 172848.92 153660 215725 2398193 3685645 34.93
 
 

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:80.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing $sw2 Physical damage. Only usable on enemies with less than 20% health. If the target dies, the Hunter will regain {$164851s1=15}% of maximum health. If Kill Shot fails to kill the target, the cooldown is reset.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.85
 
Maalus 11575 11.6% 4.1 120.84sec 1257795 0 Direct 4.1 1257787 0 1257787 0.0% 0.0% 0.0% 0.0 0 0 0.0%  

Stats details: maalus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.13 4.13 0.00 0.00 0.0000 0.0000 5193844.18 5193844.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.13 100.00% 1257787.04 553083 2280559 1260794.04 952457 1601541 5193844 5193844 0.00
 
 

Action details: maalus

Static Values
  • id:187626
  • school:arcane
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187626
  • name:Maalus
  • school:arcane
  • tooltip:
  • description:{$@spelldesc187615=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2570627.40
  • base_dd_max:2570627.40
 
Stampede 0 (5493) 0.0% (5.5%) 2.0 361.86sec 1226109 1220616

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 1220616.22 1220616.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.rapid_fire.up|buff.bloodlust.up|target.time_to_die<=25
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:
  • description:Summons all of your pets to fight your current target for {$d=40 seconds}. While in an Arena or Battleground, these pets deal only ${100+$130201m1}% of their normal damage.
 
    melee (cat) 6574 1.1% 63.7 6.32sec 7699 6431 Direct 63.7 3869 7883 6369 62.3% 0.0% 0.0% 44.3 1161 2364 62.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.71 63.71 0.00 0.00 1.1971 0.0000 490520.14 753852.01 34.93 6431.45 6431.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.61 62.25% 2364.35 1656 3330 2368.71 1795 3065 65275 100318 34.93
multistrike 16.74 37.75% 1160.54 828 1665 1162.84 828 1578 19429 29859 34.93
hit 24.02 37.71% 3868.97 2760 5550 3876.53 3018 5293 92949 142848 34.93
crit 39.69 62.29% 7883.03 5520 11100 7899.12 6643 9587 312867 480827 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (cat1) 6569 1.1% 63.7 6.32sec 7694 6427 Direct 63.7 3869 7883 6365 62.2% 0.0% 0.0% 44.3 1161 2365 62.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.71 63.71 0.00 0.00 1.1971 0.0000 490218.17 753387.92 34.93 6427.49 6427.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.62 62.31% 2364.89 1656 3330 2369.70 1877 3056 65309 100369 34.93
multistrike 16.70 37.69% 1161.28 828 1665 1163.75 828 1639 19399 29813 34.93
hit 24.10 37.83% 3869.04 2760 5550 3875.69 2973 4946 93254 143316 34.93
crit 39.61 62.17% 7883.24 5520 11100 7899.30 6715 9660 312257 479889 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (cat2) 6573 1.1% 63.7 6.32sec 7699 6431 Direct 63.7 3871 7881 6371 62.3% 0.0% 0.0% 44.3 1162 2365 62.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.71 63.71 0.00 0.00 1.1971 0.0000 490513.03 753841.07 34.93 6431.36 6431.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.58 62.28% 2364.63 1656 3330 2369.38 1795 3024 65221 100234 34.93
multistrike 16.71 37.72% 1161.53 828 1665 1163.73 846 1560 19405 29823 34.93
hit 23.99 37.66% 3870.97 2760 5550 3877.78 3066 4947 92878 142738 34.93
crit 39.72 62.34% 7880.50 5520 11100 7896.86 6663 9448 313009 481046 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (cat3) 6573 1.1% 63.7 6.32sec 7698 6431 Direct 63.7 3869 7883 6368 62.3% 0.0% 0.0% 44.3 1161 2365 62.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.71 63.71 0.00 0.00 1.1971 0.0000 490457.59 753755.88 34.93 6430.63 6430.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.62 62.28% 2365.16 1656 3330 2369.67 1846 3089 65325 100394 34.93
multistrike 16.73 37.72% 1160.88 828 1665 1163.03 828 1588 19420 29846 34.93
hit 24.05 37.75% 3868.97 2760 5550 3875.81 2934 4893 93052 143006 34.93
crit 39.66 62.25% 7883.13 5520 11100 7899.57 6579 9551 312661 480510 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (cat4) 6573 1.1% 63.7 6.32sec 7699 6431 Direct 63.7 3870 7882 6369 62.3% 0.0% 0.0% 44.4 1161 2365 62.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.71 63.71 0.00 0.00 1.1971 0.0000 490509.06 753834.97 34.93 6431.30 6431.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.61 62.25% 2365.28 1656 3330 2369.97 1802 2983 65302 100359 34.93
multistrike 16.75 37.75% 1160.85 828 1665 1163.12 828 1525 19439 29874 34.93
hit 24.03 37.72% 3870.08 2760 5550 3876.49 3039 4920 92997 142921 34.93
crit 39.68 62.28% 7881.71 5520 11100 7897.71 6655 9613 312771 480680 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Steady Shot 5903 5.9% 145.0 3.05sec 18330 11123 Direct 144.7 7848 19056 15196 65.6% 0.0% 0.0% 100.6 2354 5718 65.5%  

Stats details: steady_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.99 144.72 0.00 0.00 1.6479 0.0000 2657740.50 4084527.50 34.93 11123.19 11123.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 65.91 65.51% 5717.83 4991 9245 5721.01 5227 6563 376845 579151 34.93
multistrike 34.70 34.49% 2354.37 2215 4103 2354.29 2215 2629 81687 125541 34.93
hit 49.84 34.44% 7847.75 7384 13677 7846.86 7384 8501 391119 601088 34.93
crit 94.88 65.56% 19056.20 16636 30815 19068.06 17725 20681 1808089 2778748 34.93
 
 

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.deficit*cast_time%(14+cast_regen)>cooldown.rapid_fire.remains
Spelldata
  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes $sw2 Physical damage and generates {$77443s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
pet - mirror_image_(trinket) 14372 / 4948
Felstorm 14372 4.9% 62.3 30.54sec 35691 3704 Periodic 378.9 2957 5946 4433 50.9% 1.5% 3.6% 259.6 1379 2771 51.6% 133.4%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.31 62.31 378.89 378.89 9.6371 1.5849 2223919.28 3154425.24 29.50 3703.54 3703.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 129.0 51.60% 2771.47 2191 3960 2773.19 2484 3127 357508 357508 0.00
multistrike_crit (blocked) 5.0 1.31% 2770.31 2191 3960 2749.35 0 3960 13749 13749 0.00
multistrike 121.0 48.40% 1378.72 1096 1980 1379.51 1246 1546 166814 166814 0.00
multistrike (blocked) 4.6 1.22% 1378.96 1096 1980 1362.81 0 1980 6362 6362 0.00
hit 173.8 45.87% 2989.92 2377 4295 2991.52 2756 3322 519639 798603 34.93
hit (blocked) 6.7 1.76% 2093.58 1664 3006 2090.64 0 3006 13967 30665 54.34
crit 185.6 48.99% 6012.16 4753 8590 6015.96 5524 6665 1115988 1715098 34.93
crit (blocked) 7.1 1.87% 4209.26 3327 6013 4210.09 0 6013 29891 65626 54.40
parry 5.7 1.50% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: felstorm

Static Values
  • id:184279
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184279
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $184280m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:Strikes all nearby targets within $184280A1 yards for $184280m1% weapon damage every $t1 sec for {$d=20 seconds}. The Mirror Image cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: felstorm_tick

Static Values
  • id:184280
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184280
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc184279=Strikes all nearby targets within $184280A1 yards for $184280m1% weapon damage every $t1 sec for {$d=20 seconds}. The Mirror Image cannot perform any other abilities during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.50
 
pet - cat 6574 / 1099
melee 6574 1.1% 63.7 6.32sec 7699 6431 Direct 63.7 3869 7883 6369 62.3% 0.0% 0.0% 44.3 1161 2364 62.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.71 63.71 0.00 0.00 1.1971 0.0000 490520.14 753852.01 34.93 6431.45 6431.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.61 62.25% 2364.35 1656 3330 2368.71 1795 3065 65275 100318 34.93
multistrike 16.74 37.75% 1160.54 828 1665 1162.84 828 1578 19429 29859 34.93
hit 24.02 37.71% 3868.97 2760 5550 3876.53 3018 5293 92949 142848 34.93
crit 39.69 62.29% 7883.03 5520 11100 7899.12 6643 9587 312867 480827 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - cat1 6569 / 1098
melee 6569 1.1% 63.7 6.32sec 7694 6427 Direct 63.7 3869 7883 6365 62.2% 0.0% 0.0% 44.3 1161 2365 62.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.71 63.71 0.00 0.00 1.1971 0.0000 490218.17 753387.92 34.93 6427.49 6427.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.62 62.31% 2364.89 1656 3330 2369.70 1877 3056 65309 100369 34.93
multistrike 16.70 37.69% 1161.28 828 1665 1163.75 828 1639 19399 29813 34.93
hit 24.10 37.83% 3869.04 2760 5550 3875.69 2973 4946 93254 143316 34.93
crit 39.61 62.17% 7883.24 5520 11100 7899.30 6715 9660 312257 479889 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - cat2 6573 / 1099
melee 6573 1.1% 63.7 6.32sec 7699 6431 Direct 63.7 3871 7881 6371 62.3% 0.0% 0.0% 44.3 1162 2365 62.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.71 63.71 0.00 0.00 1.1971 0.0000 490513.03 753841.07 34.93 6431.36 6431.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.58 62.28% 2364.63 1656 3330 2369.38 1795 3024 65221 100234 34.93
multistrike 16.71 37.72% 1161.53 828 1665 1163.73 846 1560 19405 29823 34.93
hit 23.99 37.66% 3870.97 2760 5550 3877.78 3066 4947 92878 142738 34.93
crit 39.72 62.34% 7880.50 5520 11100 7896.86 6663 9448 313009 481046 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - cat3 6573 / 1099
melee 6573 1.1% 63.7 6.32sec 7698 6431 Direct 63.7 3869 7883 6368 62.3% 0.0% 0.0% 44.3 1161 2365 62.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.71 63.71 0.00 0.00 1.1971 0.0000 490457.59 753755.88 34.93 6430.63 6430.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.62 62.28% 2365.16 1656 3330 2369.67 1846 3089 65325 100394 34.93
multistrike 16.73 37.72% 1160.88 828 1665 1163.03 828 1588 19420 29846 34.93
hit 24.05 37.75% 3868.97 2760 5550 3875.81 2934 4893 93052 143006 34.93
crit 39.66 62.25% 7883.13 5520 11100 7899.57 6579 9551 312661 480510 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - cat4 6573 / 1099
melee 6573 1.1% 63.7 6.32sec 7699 6431 Direct 63.7 3870 7882 6369 62.3% 0.0% 0.0% 44.4 1161 2365 62.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.71 63.71 0.00 0.00 1.1971 0.0000 490509.06 753834.97 34.93 6431.30 6431.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 27.61 62.25% 2365.28 1656 3330 2369.97 1802 2983 65302 100359 34.93
multistrike 16.75 37.75% 1160.85 828 1665 1163.12 828 1525 19439 29874 34.93
hit 24.03 37.72% 3870.08 2760 5550 3876.49 3039 4920 92997 142921 34.93
crit 39.68 62.28% 7881.71 5520 11100 7897.71 6655 9613 312771 480680 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Mokillr
Burning Mirror 7.9 60.77sec

Stats details: burning_mirror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 7.95 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: burning_mirror

Static Values
  • id:184270
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:184270
  • name:Burning Mirror
  • school:arcane
  • tooltip:
  • description:Summons {$?s19574=false}[${$m1/2}][$m1] Mirror Images to attack your target and nearby enemies for {$184271d=20 seconds}.
 
Draenic Agility Potion (potion) 1.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 1.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: potion

Static Values
  • id:156423
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your Agility by {$s1=1000} for {$d=25 seconds}.
 
nitro_boosts 1.0 0.00sec

Stats details: nitro_boosts

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 1.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: nitro_boosts

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Rapid Fire 4.3 121.23sec

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases haste by $w1%.
  • description:Increases haste by {$s1=40}% for {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.03% 14.37% 0.0(0.0)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Careful Aim 10.7 0.0 43.6sec 37.4sec 31.38% 46.06% 0.0(0.0)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_careful_aim
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • careful_aim_1:31.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:34483
  • name:Careful Aim
  • tooltip:
  • description:Increases the critical strike chance of your Steady Shot, Focusing Shot, and Aimed Shot by {$s1=50}% on targets who are above {$s2=80}% health or while Rapid Fire is active.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Countenance of Tyranny 7.9 0.0 59.2sec 58.7sec 34.24% 34.25% 0.0(0.0)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_countenance_of_tyranny
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1585.00

Stack Uptimes

  • countenance_of_tyranny_1:34.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:183926
  • name:Countenance of Tyranny
  • tooltip:Increases Agility by {$s1=467}.
  • description:{$@spelldesc183927=Your attacks have a chance to grant {$183926s1=467} Agility for {$183926d=20 seconds}. (Approximately ${$procrppm}.2 procs per minute)}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Draenic Agility Potion 1.0 0.0 0.0sec 0.0sec 5.19% 5.21% 0.0(0.0)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your Agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Maalus 4.3 0.0 120.8sec 120.8sec 14.21% 21.36% 0.0(0.0)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_maalus
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • maalus_1:14.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187620
  • name:Maalus
  • tooltip:$?$w1>0[Damage dealt increased by $w1%. When this effect ends, the triggering ally will explode for $w1% of all damage dealt while empowered.][Contributing toward the master's Savage Hollows.]
  • description:{$@spelldesc187615=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Megawatt Filament 10.4 3.5 44.6sec 32.7sec 32.20% 32.21% 3.5(3.5)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_megawatt_filament
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:750.00

Stack Uptimes

  • megawatt_filament_1:32.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156060
  • name:Megawatt Filament
  • tooltip:Critical strike increased by $w1.
  • description:Critical strike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Nitro Boosts 1.0 0.0 0.0sec 0.0sec 1.13% 1.14% 0.0(0.0)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_nitro_boosts
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nitro_boosts_1:1.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:54861
  • name:Nitro Boosts
  • tooltip:Speed increased by {$s1=150}%.
  • description:Increase your speed by {$s1=150}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Rapid Fire 4.3 0.0 121.2sec 121.2sec 13.74% 17.79% 0.0(0.0)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rapid_fire_1:13.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases haste by $w1%.
  • description:Increases haste by {$s1=40}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Rapid Fire (_t18) 8.4 0.0 47.7sec 47.7sec 7.03% 22.78% 0.0(0.0)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_rapid_fire_t18
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:0.40

Stack Uptimes

  • rapid_fire_t18_1:7.03%

Trigger Attempt Success

  • trigger_pct:40.01%

Spelldata details

  • id:188202
  • name:Rapid Fire
  • tooltip:Increases haste by $w1%.
  • description:Increases haste by {$s1=40}% for {$d=4 seconds}.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Mastery: Sniper Training (sniper_training) 1.0 899.5 0.0sec 0.5sec 100.00% 100.00% 899.5(899.5)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_sniper_training
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sniper_training_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:76659
  • name:Mastery: Sniper Training
  • tooltip:
  • description:When you stand still for {$168809d=3 seconds}, you gain Sniper Training for {$s3=6} sec, which increases your damage, shot range, and critical strike damage by {$s1=0}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.8sec 361.8sec 16.74% 16.75% 0.0(0.0)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:16.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill of the Hunt 18.7 16.7 24.1sec 12.6sec 50.99% 73.13% 16.7(32.5)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_thrill_of_the_hunt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • thrill_of_the_hunt_1:12.10%
  • thrill_of_the_hunt_2:18.17%
  • thrill_of_the_hunt_3:20.72%

Trigger Attempt Success

  • trigger_pct:23.45%

Spelldata details

  • id:34720
  • name:Thrill of the Hunt
  • tooltip:Reduces the Focus cost of your next Arcane Shot, Aimed Shot, or Multi-Shot by {$s1=20}.
  • description:{$@spelldesc109306=You have a {$s1=6}% chance per 10 Focus spent on Focus-costing attacks to trigger Thrill of the Hunt. Thrill of the Hunt reduces the Focus cost of your next {$s2=3} Arcane Shots, Aimed Shots, or Multi-Shots by {$34720s1=20}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Stampede 2.0 0.0 361.8sec 361.8sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Mokillr_cat
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.8sec 361.8sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Mokillr_cat1
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.8sec 361.8sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Mokillr_cat2
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.8sec 361.8sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Mokillr_cat3
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.8sec 361.8sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Mokillr_cat4
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Stance of the Fierce Tiger (fierce_tiger_movement_aura)

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_fierce_tiger_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fierce_tiger_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:
  • description:Increases all damage dealt by {$s3=10}%. Grants you and your allies within $m7 yards {$166646s1=10}% increased movement speed, and improves the functionality of Jab, Expel Harm, Tiger Palm, Blackout Kick, and Rising Sun Kick.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Draenic Agility Flask

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
pickled_eel_food

Buff details

  • buff initial source:Mokillr
  • cooldown name:buff_pickled_eel_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:125.00

Stack Uptimes

  • pickled_eel_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mokillr
aimed_shot Focus 89.5 3366.9 37.6 37.6 3663.4
barrage Focus 16.0 958.1 60.0 60.0 3442.7
chimaera_shot Focus 45.1 1579.4 35.0 35.0 5738.6
Resource Gains Type Count Total Average Overflow
focus_regen Focus 915.00 2246.88 (31.48%) 2.46 0.20 0.01%
thrill_of_the_hunt_savings Focus 65.68 1313.58 (18.40%) 20.00 0.00 0.00%
steady_shot Focus 144.99 2029.11 (28.43%) 13.99 0.79 0.04%
aimed_shot Focus 77.40 1547.96 (21.69%) 20.00 0.00 0.00%
pet - cat
focus_regen Focus 136.53 0.00 (0.00%) 0.00 565.47 100.00%
pet - cat1
focus_regen Focus 136.53 0.00 (0.00%) 0.00 565.47 100.00%
pet - cat2
focus_regen Focus 136.53 0.00 (0.00%) 0.00 565.47 100.00%
pet - cat3
focus_regen Focus 136.53 0.00 (0.00%) 0.00 565.47 100.00%
pet - cat4
focus_regen Focus 136.53 0.00 (0.00%) 0.00 565.47 100.00%
Resource RPS-Gain RPS-Loss
Focus 12.94 13.12
Combat End Resource Mean Min Max
Focus 39.52 0.09 112.24

Benefits & Uptimes

Benefits %
aimed_in_careful_aim 72.8%
Uptimes %
Focus Cap 0.0%

Procs

Count Interval
starved: chimaera_shot 10.4 39.7sec
starved: barrage 69.3 6.1sec
thrill_of_the_hunt 35.4 12.6sec
tier18_2pc_mm_wasted_proc 0.6 184.9sec
tier18_2pc_mm_wasted_overwrite 4.3 121.2sec

Statistics & Data Analysis

Fight Length
Sample Data Mokillr Fight Length
Count 24999
Mean 450.01
Minimum 351.82
Maximum 558.10
Spread ( max - min ) 206.27
Range [ ( max - min ) / 2 * 100% ] 22.92%
DPS
Sample Data Mokillr Damage Per Second
Count 24999
Mean 100021.22
Minimum 87827.75
Maximum 114559.44
Spread ( max - min ) 26731.70
Range [ ( max - min ) / 2 * 100% ] 13.36%
Standard Deviation 3621.1003
5th Percentile 94308.71
95th Percentile 106269.50
( 95th Percentile - 5th Percentile ) 11960.79
Mean Distribution
Standard Deviation 22.9023
95.00% Confidence Intervall ( 99976.33 - 100066.11 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5034
0.1 Scale Factor Error with Delta=300 111934
0.05 Scale Factor Error with Delta=300 447738
0.01 Scale Factor Error with Delta=300 11193471
Priority Target DPS
Sample Data Mokillr Priority Target Damage Per Second
Count 24999
Mean 100021.22
Minimum 87827.75
Maximum 114559.44
Spread ( max - min ) 26731.70
Range [ ( max - min ) / 2 * 100% ] 13.36%
Standard Deviation 3621.1003
5th Percentile 94308.71
95th Percentile 106269.50
( 95th Percentile - 5th Percentile ) 11960.79
Mean Distribution
Standard Deviation 22.9023
95.00% Confidence Intervall ( 99976.33 - 100066.11 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5034
0.1 Scale Factor Error with Delta=300 111934
0.05 Scale Factor Error with Delta=300 447738
0.01 Scale Factor Error with Delta=300 11193471
DPS(e)
Sample Data Mokillr Damage Per Second (Effective)
Count 24999
Mean 100021.22
Minimum 87827.75
Maximum 114559.44
Spread ( max - min ) 26731.70
Range [ ( max - min ) / 2 * 100% ] 13.36%
Damage
Sample Data Mokillr Damage
Count 24999
Mean 40269396.50
Minimum 28650019.54
Maximum 52837909.29
Spread ( max - min ) 24187889.75
Range [ ( max - min ) / 2 * 100% ] 30.03%
DTPS
Sample Data Mokillr Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mokillr Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mokillr Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mokillr Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mokillr Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mokillr Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MokillrTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mokillr Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=pickled_eel
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=spell_targets.multi_shot<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=spell_targets.multi_shot>=3
6 0.00 potion,name=draenic_agility
7 0.00 glaive_toss
8 0.00 focusing_shot
Default action list Executed every time the actor is available.
# count action,conditions
9 1.00 auto_shot
A 1.00 use_item,name=torchbrazed_waistguard
B 4.34 use_item,name=maalus_the_blood_drinker
C 7.95 use_item,name=mirror_of_the_blademaster
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
0.00 potion,name=draenic_agility,if=((buff.rapid_fire.up|buff.bloodlust.up)&(cooldown.stampede.remains<1))|target.time_to_die<=25
D 45.13 chimaera_shot
E 27.09 kill_shot
F 4.32 rapid_fire
G 2.00 stampede,if=buff.rapid_fire.up|buff.bloodlust.up|target.time_to_die<=25
H 0.00 call_action_list,name=careful_aim,if=buff.careful_aim.up
0.00 explosive_trap,if=spell_targets.explosive_trap_tick>1
0.00 a_murder_of_crows
0.00 dire_beast,if=cast_regen+action.aimed_shot.cast_regen<focus.deficit
0.00 glaive_toss
0.00 powershot,if=cast_regen<focus.deficit
I 15.97 barrage
J 7.05 steady_shot,if=focus.deficit*cast_time%(14+cast_regen)>cooldown.rapid_fire.remains
Pool max focus for rapid fire so we can spam AimedShot with Careful Aim buff
0.00 focusing_shot,if=focus.deficit*cast_time%(50+cast_regen)>cooldown.rapid_fire.remains&focus<100
0.00 steady_shot,if=buff.pre_steady_focus.up&(14+cast_regen+action.aimed_shot.cast_regen)<=focus.deficit
Cast a second shot for steady focus if that won't cap us.
0.00 multishot,if=spell_targets.multi_shot>6
0.00 aimed_shot,if=talent.focusing_shot.enabled
K 8.55 aimed_shot,if=focus+cast_regen>=85
L 15.61 aimed_shot,if=buff.thrill_of_the_hunt.react&focus+cast_regen>=65
0.00 focusing_shot,if=50+cast_regen-10<focus.deficit
Allow FS to over-cap by 10 if we have nothing else to do
M 95.23 steady_shot
actions.careful_aim
# count action,conditions
0.00 glaive_toss,if=active_enemies>2
0.00 powershot,if=spell_targets.powershot>1&cast_regen<focus.deficit
0.00 barrage,if=spell_targets.barrage>1
N 65.37 aimed_shot
0.00 focusing_shot,if=50+cast_regen<focus.deficit
O 43.14 steady_shot

Sample Sequence

0169BCDFGNNNONONNNODOONONONODONONONNODONONONODOONONODONOOANCODNMMIMDMMMKLLDMMMIDMONOMKMDMNONOMDMIJJBDCFNNONONONDOONONOMDMMIMDMMMLLLDMMLMIDMMMLMDMCLMKMIMDMMMKMDMNNNNMIMDMNONNMMDMNNNOIJDJJJBCFNNNDOONONONODOONNNMMDMIMMDMMLLMMDMEEIMDMMEEKCLMDMMKEEIMDMMEEMLDMNNNNEEMDMMIEEDMONOMMDEEJJBCFGNNDNNEENNNODNMMEEIMDMMEELLLDMMMEEIDMMMEELDMMLCMLEDEMIMMDEEMMLM

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 120.0/120: 100% focus sniper_training
Pre food Fluffy_Pillow 120.0/120: 100% focus sniper_training
Pre potion Fluffy_Pillow 120.0/120: 100% focus sniper_training, draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 120.0/120: 100% focus sniper_training, draenic_agility_potion
0:00.000 use_item_maalus_the_blood_drinker Fluffy_Pillow 120.0/120: 100% focus sniper_training, draenic_agility_potion
0:00.000 use_item_mirror_of_the_blademaster Fluffy_Pillow 120.0/120: 100% focus sniper_training, maalus, draenic_agility_potion
0:00.000 chimaera_shot Fluffy_Pillow 120.0/120: 100% focus sniper_training, maalus, draenic_agility_potion
0:01.004 rapid_fire Fluffy_Pillow 90.7/120: 76% focus bloodlust, sniper_training, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:01.004 stampede Fluffy_Pillow 90.7/120: 76% focus bloodlust, rapid_fire, sniper_training, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:02.009 aimed_shot Fluffy_Pillow 98.9/120: 82% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:03.014 aimed_shot Fluffy_Pillow 77.1/120: 64% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:04.020 aimed_shot Fluffy_Pillow 55.3/120: 46% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:05.023 steady_shot Fluffy_Pillow 33.5/120: 28% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:06.029 aimed_shot Fluffy_Pillow 55.7/120: 46% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:07.033 steady_shot Fluffy_Pillow 33.9/120: 28% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:08.036 aimed_shot Fluffy_Pillow 56.1/120: 47% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:09.042 aimed_shot Fluffy_Pillow 34.3/120: 29% focus bloodlust, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:10.047 aimed_shot Fluffy_Pillow 32.5/120: 27% focus bloodlust, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:11.050 steady_shot Fluffy_Pillow 30.7/120: 26% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:12.054 chimaera_shot Fluffy_Pillow 52.9/120: 44% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, countenance_of_tyranny, megawatt_filament, draenic_agility_potion
0:13.059 steady_shot Fluffy_Pillow 26.1/120: 22% focus bloodlust, sniper_training, stampede, rapid_fire_t18, maalus, countenance_of_tyranny, draenic_agility_potion
0:14.064 steady_shot Fluffy_Pillow 48.3/120: 40% focus bloodlust, sniper_training, stampede, rapid_fire_t18, maalus, countenance_of_tyranny, draenic_agility_potion
0:15.069 aimed_shot Fluffy_Pillow 70.5/120: 59% focus bloodlust, sniper_training, stampede, rapid_fire_t18, countenance_of_tyranny, draenic_agility_potion
0:16.073 steady_shot Fluffy_Pillow 48.7/120: 41% focus bloodlust, sniper_training, stampede, rapid_fire_t18, countenance_of_tyranny, draenic_agility_potion
0:17.077 aimed_shot Fluffy_Pillow 70.9/120: 59% focus bloodlust, sniper_training, stampede, countenance_of_tyranny, draenic_agility_potion
0:18.082 steady_shot Fluffy_Pillow 46.7/120: 39% focus bloodlust, sniper_training, stampede, countenance_of_tyranny, draenic_agility_potion
0:19.458 aimed_shot Fluffy_Pillow 68.7/120: 57% focus bloodlust, sniper_training, stampede, countenance_of_tyranny, draenic_agility_potion
0:20.462 steady_shot Fluffy_Pillow 44.6/120: 37% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:21.840 chimaera_shot Fluffy_Pillow 66.6/120: 56% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:22.844 steady_shot Fluffy_Pillow 37.5/120: 31% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:24.222 aimed_shot Fluffy_Pillow 59.5/120: 50% focus bloodlust, sniper_training, stampede
0:25.227 steady_shot Fluffy_Pillow 35.4/120: 29% focus bloodlust, sniper_training, stampede
0:26.603 aimed_shot Fluffy_Pillow 57.4/120: 48% focus bloodlust, sniper_training, stampede
0:27.607 steady_shot Fluffy_Pillow 33.2/120: 28% focus bloodlust, sniper_training, stampede
0:28.984 aimed_shot Fluffy_Pillow 55.3/120: 46% focus bloodlust, sniper_training, stampede
0:29.989 aimed_shot Fluffy_Pillow 31.1/120: 26% focus bloodlust, thrill_of_the_hunt(2), sniper_training, stampede
0:30.994 steady_shot Fluffy_Pillow 27.0/120: 22% focus bloodlust, thrill_of_the_hunt, sniper_training, stampede
0:32.369 chimaera_shot Fluffy_Pillow 49.0/120: 41% focus bloodlust, thrill_of_the_hunt, sniper_training, stampede, megawatt_filament
0:33.373 steady_shot Fluffy_Pillow 19.9/120: 17% focus bloodlust, thrill_of_the_hunt, sniper_training, stampede, megawatt_filament
0:34.751 aimed_shot Fluffy_Pillow 41.9/120: 35% focus bloodlust, thrill_of_the_hunt, sniper_training, stampede, megawatt_filament
0:35.756 steady_shot Fluffy_Pillow 37.8/120: 31% focus bloodlust, sniper_training, stampede, megawatt_filament
0:37.132 aimed_shot Fluffy_Pillow 59.8/120: 50% focus bloodlust, sniper_training, stampede, megawatt_filament
0:38.136 steady_shot Fluffy_Pillow 35.6/120: 30% focus bloodlust, sniper_training, stampede, megawatt_filament
0:39.512 aimed_shot Fluffy_Pillow 57.7/120: 48% focus bloodlust, sniper_training, stampede, megawatt_filament
0:40.517 steady_shot Fluffy_Pillow 33.5/120: 28% focus bloodlust, sniper_training, stampede, megawatt_filament
0:41.894 chimaera_shot Fluffy_Pillow 53.7/120: 45% focus sniper_training, megawatt_filament
0:42.898 steady_shot Fluffy_Pillow 23.2/120: 19% focus sniper_training, megawatt_filament
0:44.687 steady_shot Fluffy_Pillow 45.2/120: 38% focus sniper_training
0:46.474 aimed_shot Fluffy_Pillow 67.2/120: 56% focus sniper_training
0:47.479 steady_shot Fluffy_Pillow 41.7/120: 35% focus sniper_training
0:49.267 aimed_shot Fluffy_Pillow 63.8/120: 53% focus sniper_training
0:50.273 steady_shot Fluffy_Pillow 38.3/120: 32% focus sniper_training
0:52.062 chimaera_shot Fluffy_Pillow 60.3/120: 50% focus sniper_training
0:53.066 steady_shot Fluffy_Pillow 29.8/120: 25% focus sniper_training
0:54.853 aimed_shot Fluffy_Pillow 51.8/120: 43% focus sniper_training
0:55.856 steady_shot Fluffy_Pillow 26.3/120: 22% focus sniper_training
0:57.642 steady_shot Fluffy_Pillow 48.3/120: 40% focus sniper_training
0:59.430 use_item_torchbrazed_waistguard Fluffy_Pillow 70.3/120: 59% focus sniper_training
0:59.430 aimed_shot Fluffy_Pillow 70.3/120: 59% focus nitro_boosts, sniper_training
1:00.435 use_item_mirror_of_the_blademaster Fluffy_Pillow 44.8/120: 37% focus nitro_boosts, sniper_training
1:00.435 steady_shot Fluffy_Pillow 44.8/120: 37% focus nitro_boosts, sniper_training
1:02.221 chimaera_shot Fluffy_Pillow 66.9/120: 56% focus nitro_boosts, sniper_training
1:03.225 aimed_shot Fluffy_Pillow 36.4/120: 30% focus nitro_boosts, thrill_of_the_hunt(3), sniper_training
1:04.229 steady_shot Fluffy_Pillow 30.9/120: 26% focus nitro_boosts, thrill_of_the_hunt(2), sniper_training
1:06.016 steady_shot Fluffy_Pillow 52.9/120: 44% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
1:07.804 barrage Fluffy_Pillow 74.9/120: 62% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
1:10.749 steady_shot Fluffy_Pillow 28.1/120: 23% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
1:12.537 chimaera_shot Fluffy_Pillow 50.1/120: 42% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
1:13.542 steady_shot Fluffy_Pillow 19.6/120: 16% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
1:15.331 steady_shot Fluffy_Pillow 41.6/120: 35% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
1:17.116 steady_shot Fluffy_Pillow 63.7/120: 53% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
1:18.903 aimed_shot Fluffy_Pillow 85.7/120: 71% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
1:19.905 aimed_shot Fluffy_Pillow 80.2/120: 67% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
1:20.909 aimed_shot Fluffy_Pillow 74.7/120: 62% focus thrill_of_the_hunt, sniper_training, countenance_of_tyranny
1:21.914 chimaera_shot Fluffy_Pillow 69.2/120: 58% focus sniper_training, countenance_of_tyranny
1:22.918 steady_shot Fluffy_Pillow 38.7/120: 32% focus sniper_training, countenance_of_tyranny
1:24.705 steady_shot Fluffy_Pillow 60.7/120: 51% focus sniper_training, countenance_of_tyranny
1:26.492 steady_shot Fluffy_Pillow 82.7/120: 69% focus sniper_training
1:28.280 barrage Fluffy_Pillow 104.7/120: 87% focus sniper_training
1:31.150 chimaera_shot Fluffy_Pillow 57.6/120: 48% focus sniper_training
1:32.155 steady_shot Fluffy_Pillow 27.1/120: 23% focus sniper_training, rapid_fire_t18
1:33.434 steady_shot Fluffy_Pillow 49.1/120: 41% focus careful_aim, sniper_training, rapid_fire_t18
1:34.712 aimed_shot Fluffy_Pillow 71.2/120: 59% focus careful_aim, sniper_training, rapid_fire_t18
1:35.719 steady_shot Fluffy_Pillow 47.5/120: 40% focus careful_aim, sniper_training, rapid_fire_t18
1:36.994 steady_shot Fluffy_Pillow 68.0/120: 57% focus sniper_training
1:38.781 aimed_shot Fluffy_Pillow 90.0/120: 75% focus sniper_training
1:39.786 steady_shot Fluffy_Pillow 44.5/120: 37% focus sniper_training
1:41.572 chimaera_shot Fluffy_Pillow 66.5/120: 55% focus sniper_training
1:42.575 steady_shot Fluffy_Pillow 36.0/120: 30% focus sniper_training, rapid_fire_t18
1:43.854 aimed_shot Fluffy_Pillow 58.0/120: 48% focus careful_aim, sniper_training, rapid_fire_t18
1:44.855 steady_shot Fluffy_Pillow 34.3/120: 29% focus careful_aim, sniper_training, rapid_fire_t18
1:46.134 aimed_shot Fluffy_Pillow 56.4/120: 47% focus careful_aim, sniper_training, rapid_fire_t18, megawatt_filament
1:47.140 steady_shot Fluffy_Pillow 31.7/120: 26% focus careful_aim, sniper_training, megawatt_filament
1:48.928 steady_shot Fluffy_Pillow 53.7/120: 45% focus sniper_training, megawatt_filament
1:50.716 chimaera_shot Fluffy_Pillow 75.7/120: 63% focus sniper_training, megawatt_filament
1:51.721 steady_shot Fluffy_Pillow 45.2/120: 38% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
1:53.509 barrage Fluffy_Pillow 67.2/120: 56% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
1:56.445 steady_shot Fluffy_Pillow 20.4/120: 17% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
1:58.231 steady_shot Fluffy_Pillow 42.4/120: 35% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
2:00.018 use_item_maalus_the_blood_drinker Fluffy_Pillow 64.4/120: 54% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
2:00.018 chimaera_shot Fluffy_Pillow 64.4/120: 54% focus thrill_of_the_hunt(3), sniper_training, maalus, countenance_of_tyranny
2:01.021 use_item_mirror_of_the_blademaster Fluffy_Pillow 33.9/120: 28% focus thrill_of_the_hunt(3), sniper_training, rapid_fire_t18, maalus, countenance_of_tyranny
2:01.021 rapid_fire Fluffy_Pillow 33.9/120: 28% focus careful_aim, thrill_of_the_hunt(3), sniper_training, rapid_fire_t18, maalus, countenance_of_tyranny
2:01.021 aimed_shot Fluffy_Pillow 33.9/120: 28% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:02.026 aimed_shot Fluffy_Pillow 30.2/120: 25% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:03.032 steady_shot Fluffy_Pillow 26.5/120: 22% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:04.312 aimed_shot Fluffy_Pillow 48.6/120: 40% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:05.316 steady_shot Fluffy_Pillow 44.9/120: 37% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:06.597 aimed_shot Fluffy_Pillow 66.9/120: 56% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:07.602 steady_shot Fluffy_Pillow 43.2/120: 36% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:08.881 aimed_shot Fluffy_Pillow 65.3/120: 54% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:09.886 chimaera_shot Fluffy_Pillow 41.6/120: 35% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:10.891 steady_shot Fluffy_Pillow 12.9/120: 11% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:12.170 steady_shot Fluffy_Pillow 34.9/120: 29% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:13.447 aimed_shot Fluffy_Pillow 56.9/120: 47% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:14.451 steady_shot Fluffy_Pillow 33.2/120: 28% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
2:15.729 aimed_shot Fluffy_Pillow 55.3/120: 46% focus careful_aim, rapid_fire, sniper_training, countenance_of_tyranny
2:16.734 steady_shot Fluffy_Pillow 10.3/120: 9% focus careful_aim, sniper_training, countenance_of_tyranny
2:18.522 steady_shot Fluffy_Pillow 32.3/120: 27% focus sniper_training
2:20.309 chimaera_shot Fluffy_Pillow 54.3/120: 45% focus sniper_training
2:21.314 steady_shot Fluffy_Pillow 23.8/120: 20% focus sniper_training
2:23.100 steady_shot Fluffy_Pillow 45.8/120: 38% focus sniper_training
2:24.887 barrage Fluffy_Pillow 67.9/120: 57% focus thrill_of_the_hunt(3), sniper_training
2:27.806 steady_shot Fluffy_Pillow 20.9/120: 17% focus thrill_of_the_hunt(3), sniper_training
2:29.592 chimaera_shot Fluffy_Pillow 43.0/120: 36% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
2:30.596 steady_shot Fluffy_Pillow 12.5/120: 10% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
2:32.384 steady_shot Fluffy_Pillow 34.5/120: 29% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
2:34.171 steady_shot Fluffy_Pillow 56.5/120: 47% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny, megawatt_filament
2:35.959 aimed_shot Fluffy_Pillow 78.5/120: 65% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny, megawatt_filament
2:36.964 aimed_shot Fluffy_Pillow 73.0/120: 61% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny, megawatt_filament
2:37.968 aimed_shot Fluffy_Pillow 67.5/120: 56% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny, megawatt_filament
2:38.971 chimaera_shot Fluffy_Pillow 62.0/120: 52% focus thrill_of_the_hunt, sniper_training, countenance_of_tyranny, megawatt_filament
2:39.976 steady_shot Fluffy_Pillow 31.5/120: 26% focus thrill_of_the_hunt, sniper_training, countenance_of_tyranny, megawatt_filament
2:41.762 steady_shot Fluffy_Pillow 53.5/120: 45% focus thrill_of_the_hunt, sniper_training, countenance_of_tyranny, megawatt_filament
2:43.548 aimed_shot Fluffy_Pillow 75.5/120: 63% focus thrill_of_the_hunt, sniper_training, countenance_of_tyranny, megawatt_filament
2:44.553 steady_shot Fluffy_Pillow 70.0/120: 58% focus sniper_training, countenance_of_tyranny, megawatt_filament
2:46.341 barrage Fluffy_Pillow 92.1/120: 77% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
2:49.279 chimaera_shot Fluffy_Pillow 45.2/120: 38% focus thrill_of_the_hunt(3), sniper_training
2:50.284 steady_shot Fluffy_Pillow 14.8/120: 12% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
2:52.070 steady_shot Fluffy_Pillow 36.8/120: 31% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
2:53.857 steady_shot Fluffy_Pillow 58.8/120: 49% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
2:55.645 aimed_shot Fluffy_Pillow 80.8/120: 67% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
2:56.651 steady_shot Fluffy_Pillow 55.3/120: 46% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
2:58.438 chimaera_shot Fluffy_Pillow 77.3/120: 64% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
2:59.442 steady_shot Fluffy_Pillow 46.8/120: 39% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
3:01.232 use_item_mirror_of_the_blademaster Fluffy_Pillow 68.9/120: 57% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
3:01.232 aimed_shot Fluffy_Pillow 68.9/120: 57% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
3:02.237 steady_shot Fluffy_Pillow 63.4/120: 53% focus sniper_training, megawatt_filament
3:04.026 aimed_shot Fluffy_Pillow 85.4/120: 71% focus sniper_training, megawatt_filament
3:05.031 steady_shot Fluffy_Pillow 59.9/120: 50% focus sniper_training, megawatt_filament
3:06.819 barrage Fluffy_Pillow 81.9/120: 68% focus sniper_training
3:09.730 steady_shot Fluffy_Pillow 35.0/120: 29% focus sniper_training
3:11.519 chimaera_shot Fluffy_Pillow 57.0/120: 47% focus sniper_training
3:12.524 steady_shot Fluffy_Pillow 26.5/120: 22% focus sniper_training
3:14.312 steady_shot Fluffy_Pillow 48.5/120: 40% focus sniper_training
3:16.099 steady_shot Fluffy_Pillow 70.5/120: 59% focus sniper_training
3:17.888 aimed_shot Fluffy_Pillow 92.5/120: 77% focus sniper_training
3:18.893 steady_shot Fluffy_Pillow 47.1/120: 39% focus sniper_training
3:20.680 chimaera_shot Fluffy_Pillow 69.1/120: 58% focus sniper_training
3:21.685 steady_shot Fluffy_Pillow 38.6/120: 32% focus thrill_of_the_hunt(3), sniper_training, rapid_fire_t18
3:22.964 aimed_shot Fluffy_Pillow 60.6/120: 51% focus careful_aim, thrill_of_the_hunt(3), sniper_training, rapid_fire_t18
3:23.970 aimed_shot Fluffy_Pillow 56.9/120: 47% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18
3:24.975 aimed_shot Fluffy_Pillow 53.2/120: 44% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18
3:25.980 aimed_shot Fluffy_Pillow 49.0/120: 41% focus careful_aim, thrill_of_the_hunt, sniper_training
3:26.985 steady_shot Fluffy_Pillow 43.5/120: 36% focus sniper_training
3:28.771 barrage Fluffy_Pillow 65.5/120: 55% focus thrill_of_the_hunt(3), sniper_training
3:31.720 steady_shot Fluffy_Pillow 18.8/120: 16% focus thrill_of_the_hunt(3), sniper_training
3:33.506 chimaera_shot Fluffy_Pillow 40.8/120: 34% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
3:34.512 steady_shot Fluffy_Pillow 10.3/120: 9% focus thrill_of_the_hunt(3), sniper_training, rapid_fire_t18, megawatt_filament
3:35.792 aimed_shot Fluffy_Pillow 32.3/120: 27% focus careful_aim, thrill_of_the_hunt(3), sniper_training, rapid_fire_t18, megawatt_filament
3:36.795 steady_shot Fluffy_Pillow 28.6/120: 24% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, megawatt_filament
3:38.074 aimed_shot Fluffy_Pillow 50.7/120: 42% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, megawatt_filament
3:39.078 aimed_shot Fluffy_Pillow 45.9/120: 38% focus careful_aim, thrill_of_the_hunt, sniper_training, megawatt_filament
3:40.084 steady_shot Fluffy_Pillow 40.4/120: 34% focus sniper_training, megawatt_filament
3:41.872 steady_shot Fluffy_Pillow 62.5/120: 52% focus sniper_training, megawatt_filament
3:43.659 chimaera_shot Fluffy_Pillow 84.5/120: 70% focus sniper_training, megawatt_filament
3:44.663 steady_shot Fluffy_Pillow 54.0/120: 45% focus sniper_training, rapid_fire_t18, megawatt_filament
3:45.943 aimed_shot Fluffy_Pillow 76.0/120: 63% focus careful_aim, sniper_training, rapid_fire_t18, countenance_of_tyranny
3:46.946 aimed_shot Fluffy_Pillow 52.3/120: 44% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, countenance_of_tyranny
3:47.950 aimed_shot Fluffy_Pillow 48.6/120: 41% focus careful_aim, thrill_of_the_hunt, sniper_training, rapid_fire_t18, countenance_of_tyranny
3:48.955 steady_shot Fluffy_Pillow 44.4/120: 37% focus careful_aim, sniper_training, countenance_of_tyranny
3:50.744 barrage Fluffy_Pillow 66.4/120: 55% focus sniper_training, countenance_of_tyranny
3:53.614 steady_shot Fluffy_Pillow 19.3/120: 16% focus sniper_training, countenance_of_tyranny
3:55.403 chimaera_shot Fluffy_Pillow 41.3/120: 34% focus sniper_training, countenance_of_tyranny
3:56.408 steady_shot Fluffy_Pillow 10.8/120: 9% focus sniper_training, countenance_of_tyranny
3:58.196 steady_shot Fluffy_Pillow 32.8/120: 27% focus sniper_training, countenance_of_tyranny
3:59.984 steady_shot Fluffy_Pillow 54.9/120: 46% focus sniper_training, countenance_of_tyranny
4:01.774 use_item_maalus_the_blood_drinker Fluffy_Pillow 76.9/120: 64% focus sniper_training, countenance_of_tyranny
4:01.774 use_item_mirror_of_the_blademaster Fluffy_Pillow 76.9/120: 64% focus sniper_training, maalus, countenance_of_tyranny
4:01.774 rapid_fire Fluffy_Pillow 76.9/120: 64% focus sniper_training, maalus, countenance_of_tyranny
4:01.774 aimed_shot Fluffy_Pillow 76.9/120: 64% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
4:02.777 aimed_shot Fluffy_Pillow 53.2/120: 44% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, countenance_of_tyranny
4:03.781 aimed_shot Fluffy_Pillow 49.5/120: 41% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, maalus, countenance_of_tyranny
4:04.784 chimaera_shot Fluffy_Pillow 45.8/120: 38% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
4:05.788 steady_shot Fluffy_Pillow 17.1/120: 14% focus careful_aim, rapid_fire, sniper_training, maalus, countenance_of_tyranny
4:07.068 steady_shot Fluffy_Pillow 39.1/120: 33% focus careful_aim, rapid_fire, sniper_training, maalus
4:08.348 aimed_shot Fluffy_Pillow 61.2/120: 51% focus careful_aim, rapid_fire, sniper_training, maalus
4:09.352 steady_shot Fluffy_Pillow 37.5/120: 31% focus careful_aim, rapid_fire, sniper_training, maalus
4:10.631 aimed_shot Fluffy_Pillow 59.5/120: 50% focus careful_aim, rapid_fire, sniper_training, maalus
4:11.635 steady_shot Fluffy_Pillow 35.8/120: 30% focus careful_aim, rapid_fire, sniper_training, maalus
4:12.913 aimed_shot Fluffy_Pillow 57.8/120: 48% focus careful_aim, rapid_fire, sniper_training, maalus
4:13.920 steady_shot Fluffy_Pillow 34.2/120: 28% focus careful_aim, rapid_fire, sniper_training, maalus
4:15.199 chimaera_shot Fluffy_Pillow 56.2/120: 47% focus careful_aim, rapid_fire, sniper_training, maalus
4:16.203 steady_shot Fluffy_Pillow 27.5/120: 23% focus careful_aim, sniper_training, rapid_fire_t18, maalus
4:17.480 steady_shot Fluffy_Pillow 49.5/120: 41% focus careful_aim, sniper_training, rapid_fire_t18
4:18.758 aimed_shot Fluffy_Pillow 71.5/120: 60% focus careful_aim, sniper_training, rapid_fire_t18, countenance_of_tyranny
4:19.762 aimed_shot Fluffy_Pillow 47.8/120: 40% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, countenance_of_tyranny
4:20.765 aimed_shot Fluffy_Pillow 43.1/120: 36% focus careful_aim, thrill_of_the_hunt, sniper_training, countenance_of_tyranny
4:21.770 steady_shot Fluffy_Pillow 37.6/120: 31% focus sniper_training, countenance_of_tyranny
4:23.558 steady_shot Fluffy_Pillow 59.6/120: 50% focus sniper_training, countenance_of_tyranny
4:25.345 chimaera_shot Fluffy_Pillow 81.7/120: 68% focus sniper_training, countenance_of_tyranny
4:26.349 steady_shot Fluffy_Pillow 51.2/120: 43% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
4:28.139 barrage Fluffy_Pillow 73.2/120: 61% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
4:31.065 steady_shot Fluffy_Pillow 26.3/120: 22% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
4:32.851 steady_shot Fluffy_Pillow 48.3/120: 40% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
4:34.637 chimaera_shot Fluffy_Pillow 70.3/120: 59% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
4:35.644 steady_shot Fluffy_Pillow 39.8/120: 33% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
4:37.433 steady_shot Fluffy_Pillow 61.9/120: 52% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
4:39.219 aimed_shot Fluffy_Pillow 83.9/120: 70% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:40.225 aimed_shot Fluffy_Pillow 78.4/120: 65% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
4:41.231 steady_shot Fluffy_Pillow 52.9/120: 44% focus sniper_training, megawatt_filament
4:43.019 steady_shot Fluffy_Pillow 74.9/120: 62% focus sniper_training, megawatt_filament
4:44.807 chimaera_shot Fluffy_Pillow 96.9/120: 81% focus sniper_training, megawatt_filament
4:45.812 steady_shot Fluffy_Pillow 66.4/120: 55% focus sniper_training, megawatt_filament
4:47.600 kill_shot Fluffy_Pillow 88.5/120: 74% focus sniper_training, megawatt_filament
4:48.606 kill_shot Fluffy_Pillow 93.0/120: 77% focus sniper_training, megawatt_filament
4:49.609 barrage Fluffy_Pillow 97.5/120: 81% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:52.518 steady_shot Fluffy_Pillow 50.5/120: 42% focus thrill_of_the_hunt(3), sniper_training
4:54.303 chimaera_shot Fluffy_Pillow 72.5/120: 60% focus thrill_of_the_hunt(3), sniper_training
4:55.308 steady_shot Fluffy_Pillow 42.0/120: 35% focus thrill_of_the_hunt(3), sniper_training
4:57.096 steady_shot Fluffy_Pillow 64.0/120: 53% focus thrill_of_the_hunt(3), sniper_training
4:58.881 kill_shot Fluffy_Pillow 86.1/120: 72% focus thrill_of_the_hunt(3), sniper_training
4:59.886 kill_shot Fluffy_Pillow 90.6/120: 75% focus thrill_of_the_hunt(3), sniper_training
5:00.890 aimed_shot Fluffy_Pillow 95.1/120: 79% focus thrill_of_the_hunt(3), sniper_training
5:01.895 use_item_mirror_of_the_blademaster Fluffy_Pillow 69.6/120: 58% focus thrill_of_the_hunt(2), sniper_training
5:01.895 aimed_shot Fluffy_Pillow 69.6/120: 58% focus thrill_of_the_hunt(2), sniper_training
5:02.900 steady_shot Fluffy_Pillow 64.1/120: 53% focus thrill_of_the_hunt, sniper_training
5:04.687 chimaera_shot Fluffy_Pillow 86.1/120: 72% focus sniper_training
5:05.692 steady_shot Fluffy_Pillow 55.6/120: 46% focus sniper_training
5:07.480 steady_shot Fluffy_Pillow 77.6/120: 65% focus sniper_training
5:09.267 aimed_shot Fluffy_Pillow 99.6/120: 83% focus sniper_training
5:10.272 kill_shot Fluffy_Pillow 54.1/120: 45% focus thrill_of_the_hunt(2), sniper_training
5:11.277 kill_shot Fluffy_Pillow 58.6/120: 49% focus thrill_of_the_hunt(2), sniper_training
5:12.282 barrage Fluffy_Pillow 63.2/120: 53% focus thrill_of_the_hunt(3), sniper_training
5:15.212 steady_shot Fluffy_Pillow 16.3/120: 14% focus thrill_of_the_hunt(3), sniper_training
5:16.999 chimaera_shot Fluffy_Pillow 38.3/120: 32% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:18.003 steady_shot Fluffy_Pillow 7.8/120: 7% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:19.790 steady_shot Fluffy_Pillow 29.8/120: 25% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:21.576 kill_shot Fluffy_Pillow 51.8/120: 43% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:22.581 kill_shot Fluffy_Pillow 56.3/120: 47% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:23.585 steady_shot Fluffy_Pillow 60.8/120: 51% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:25.373 aimed_shot Fluffy_Pillow 82.9/120: 69% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:26.377 chimaera_shot Fluffy_Pillow 77.4/120: 64% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
5:27.382 steady_shot Fluffy_Pillow 46.9/120: 39% focus thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, megawatt_filament
5:28.662 aimed_shot Fluffy_Pillow 68.9/120: 57% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, megawatt_filament
5:29.667 aimed_shot Fluffy_Pillow 65.2/120: 54% focus careful_aim, thrill_of_the_hunt, sniper_training, rapid_fire_t18
5:30.674 aimed_shot Fluffy_Pillow 61.6/120: 51% focus careful_aim, sniper_training, rapid_fire_t18
5:31.677 aimed_shot Fluffy_Pillow 37.3/120: 31% focus careful_aim, thrill_of_the_hunt(2), sniper_training
5:32.682 kill_shot Fluffy_Pillow 31.8/120: 27% focus thrill_of_the_hunt(2), sniper_training
5:33.688 kill_shot Fluffy_Pillow 36.3/120: 30% focus thrill_of_the_hunt(2), sniper_training
5:34.692 steady_shot Fluffy_Pillow 40.8/120: 34% focus thrill_of_the_hunt(2), sniper_training
5:36.479 chimaera_shot Fluffy_Pillow 62.8/120: 52% focus thrill_of_the_hunt(2), sniper_training
5:37.484 steady_shot Fluffy_Pillow 32.4/120: 27% focus thrill_of_the_hunt(2), sniper_training
5:39.272 steady_shot Fluffy_Pillow 54.4/120: 45% focus thrill_of_the_hunt(2), sniper_training
5:41.058 barrage Fluffy_Pillow 76.4/120: 64% focus thrill_of_the_hunt(2), sniper_training
5:43.931 kill_shot Fluffy_Pillow 29.3/120: 24% focus thrill_of_the_hunt(2), sniper_training
5:44.937 kill_shot Fluffy_Pillow 33.8/120: 28% focus thrill_of_the_hunt(2), sniper_training
5:45.943 chimaera_shot Fluffy_Pillow 38.3/120: 32% focus thrill_of_the_hunt(2), sniper_training
5:46.948 steady_shot Fluffy_Pillow 7.8/120: 7% focus sniper_training, rapid_fire_t18
5:48.226 steady_shot Fluffy_Pillow 29.8/120: 25% focus careful_aim, sniper_training, rapid_fire_t18
5:49.504 aimed_shot Fluffy_Pillow 51.9/120: 43% focus careful_aim, sniper_training, rapid_fire_t18
5:50.507 steady_shot Fluffy_Pillow 28.2/120: 23% focus careful_aim, sniper_training, rapid_fire_t18
5:51.786 steady_shot Fluffy_Pillow 48.7/120: 41% focus sniper_training
5:53.574 steady_shot Fluffy_Pillow 70.7/120: 59% focus sniper_training
5:55.361 chimaera_shot Fluffy_Pillow 92.7/120: 77% focus sniper_training
5:56.366 kill_shot Fluffy_Pillow 62.2/120: 52% focus thrill_of_the_hunt(3), sniper_training
5:57.370 kill_shot Fluffy_Pillow 66.7/120: 56% focus thrill_of_the_hunt(3), sniper_training
5:58.374 steady_shot Fluffy_Pillow 71.2/120: 59% focus thrill_of_the_hunt(3), sniper_training
6:00.161 steady_shot Fluffy_Pillow 93.2/120: 78% focus thrill_of_the_hunt(3), sniper_training
6:01.949 use_item_maalus_the_blood_drinker Fluffy_Pillow 115.2/120: 96% focus thrill_of_the_hunt(3), sniper_training
6:01.949 use_item_mirror_of_the_blademaster Fluffy_Pillow 115.2/120: 96% focus thrill_of_the_hunt(3), sniper_training, maalus
6:01.949 rapid_fire Fluffy_Pillow 115.2/120: 96% focus thrill_of_the_hunt(3), sniper_training, maalus
6:01.949 stampede Fluffy_Pillow 115.2/120: 96% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, maalus
6:02.953 aimed_shot Fluffy_Pillow 120.0/120: 100% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, stampede, maalus
6:03.958 aimed_shot Fluffy_Pillow 116.3/120: 97% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus
6:04.963 chimaera_shot Fluffy_Pillow 112.6/120: 94% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus
6:05.966 aimed_shot Fluffy_Pillow 83.9/120: 70% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, stampede, maalus
6:06.971 aimed_shot Fluffy_Pillow 80.2/120: 67% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus
6:07.974 kill_shot Fluffy_Pillow 76.5/120: 64% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus
6:08.978 kill_shot Fluffy_Pillow 82.8/120: 69% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus
6:09.983 aimed_shot Fluffy_Pillow 89.1/120: 74% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus
6:10.988 aimed_shot Fluffy_Pillow 85.4/120: 71% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:11.992 aimed_shot Fluffy_Pillow 61.8/120: 51% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:12.997 steady_shot Fluffy_Pillow 38.1/120: 32% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:14.276 chimaera_shot Fluffy_Pillow 60.1/120: 50% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:15.281 aimed_shot Fluffy_Pillow 31.4/120: 26% focus careful_aim, thrill_of_the_hunt(3), sniper_training, stampede, maalus
6:16.285 steady_shot Fluffy_Pillow 25.9/120: 22% focus thrill_of_the_hunt(2), sniper_training, stampede, maalus
6:18.072 steady_shot Fluffy_Pillow 47.9/120: 40% focus thrill_of_the_hunt(2), sniper_training, stampede
6:19.861 kill_shot Fluffy_Pillow 69.9/120: 58% focus thrill_of_the_hunt(2), sniper_training, stampede
6:20.866 kill_shot Fluffy_Pillow 74.4/120: 62% focus thrill_of_the_hunt(2), sniper_training, stampede
6:21.869 barrage Fluffy_Pillow 78.9/120: 66% focus thrill_of_the_hunt(3), sniper_training, stampede
6:24.756 steady_shot Fluffy_Pillow 31.9/120: 27% focus thrill_of_the_hunt(3), sniper_training, stampede
6:26.544 chimaera_shot Fluffy_Pillow 53.9/120: 45% focus thrill_of_the_hunt(3), sniper_training, stampede, countenance_of_tyranny
6:27.547 steady_shot Fluffy_Pillow 23.4/120: 20% focus thrill_of_the_hunt(3), sniper_training, stampede, countenance_of_tyranny
6:29.337 steady_shot Fluffy_Pillow 45.4/120: 38% focus thrill_of_the_hunt(3), sniper_training, stampede, countenance_of_tyranny
6:31.124 kill_shot Fluffy_Pillow 67.4/120: 56% focus thrill_of_the_hunt(3), sniper_training, stampede, countenance_of_tyranny
6:32.129 kill_shot Fluffy_Pillow 72.0/120: 60% focus thrill_of_the_hunt(3), sniper_training, stampede, countenance_of_tyranny
6:33.133 aimed_shot Fluffy_Pillow 76.5/120: 64% focus thrill_of_the_hunt(3), sniper_training, stampede, countenance_of_tyranny
6:34.137 aimed_shot Fluffy_Pillow 71.0/120: 59% focus thrill_of_the_hunt(2), sniper_training, stampede, countenance_of_tyranny
6:35.142 aimed_shot Fluffy_Pillow 65.5/120: 55% focus thrill_of_the_hunt, sniper_training, stampede, countenance_of_tyranny, megawatt_filament
6:36.148 chimaera_shot Fluffy_Pillow 40.0/120: 33% focus thrill_of_the_hunt(2), sniper_training, stampede, countenance_of_tyranny, megawatt_filament
6:37.152 steady_shot Fluffy_Pillow 9.5/120: 8% focus thrill_of_the_hunt(2), sniper_training, stampede, countenance_of_tyranny, megawatt_filament
6:38.941 steady_shot Fluffy_Pillow 31.5/120: 26% focus thrill_of_the_hunt(2), sniper_training, stampede, countenance_of_tyranny, megawatt_filament
6:40.729 steady_shot Fluffy_Pillow 53.5/120: 45% focus thrill_of_the_hunt(2), sniper_training, stampede, countenance_of_tyranny, megawatt_filament
6:42.516 kill_shot Fluffy_Pillow 75.5/120: 63% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny, megawatt_filament
6:43.520 kill_shot Fluffy_Pillow 80.0/120: 67% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny, megawatt_filament
6:44.523 barrage Fluffy_Pillow 84.5/120: 70% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny, megawatt_filament
6:47.410 chimaera_shot Fluffy_Pillow 37.5/120: 31% focus thrill_of_the_hunt(3), sniper_training
6:48.415 steady_shot Fluffy_Pillow 7.0/120: 6% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
6:50.203 steady_shot Fluffy_Pillow 29.0/120: 24% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
6:51.991 steady_shot Fluffy_Pillow 51.0/120: 43% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
6:53.778 kill_shot Fluffy_Pillow 73.0/120: 61% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
6:54.783 kill_shot Fluffy_Pillow 77.6/120: 65% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
6:55.786 aimed_shot Fluffy_Pillow 82.0/120: 68% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
6:56.791 chimaera_shot Fluffy_Pillow 56.6/120: 47% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
6:57.795 steady_shot Fluffy_Pillow 26.1/120: 22% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
6:59.582 steady_shot Fluffy_Pillow 48.1/120: 40% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
7:01.369 aimed_shot Fluffy_Pillow 70.1/120: 58% focus thrill_of_the_hunt(3), sniper_training, countenance_of_tyranny
7:02.373 use_item_mirror_of_the_blademaster Fluffy_Pillow 44.6/120: 37% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
7:02.373 steady_shot Fluffy_Pillow 44.6/120: 37% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
7:04.159 aimed_shot Fluffy_Pillow 66.6/120: 55% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
7:05.163 kill_shot Fluffy_Pillow 61.1/120: 51% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
7:06.167 chimaera_shot Fluffy_Pillow 65.6/120: 55% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
7:07.172 kill_shot Fluffy_Pillow 35.1/120: 29% focus thrill_of_the_hunt(2), sniper_training, countenance_of_tyranny
7:08.177 steady_shot Fluffy_Pillow 39.6/120: 33% focus thrill_of_the_hunt(2), sniper_training
7:09.965 barrage Fluffy_Pillow 61.6/120: 51% focus thrill_of_the_hunt(3), sniper_training
7:12.857 steady_shot Fluffy_Pillow 14.6/120: 12% focus thrill_of_the_hunt(3), sniper_training
7:14.644 steady_shot Fluffy_Pillow 36.6/120: 31% focus thrill_of_the_hunt(3), sniper_training
7:16.432 chimaera_shot Fluffy_Pillow 58.6/120: 49% focus thrill_of_the_hunt(3), sniper_training
7:17.438 kill_shot Fluffy_Pillow 28.2/120: 23% focus thrill_of_the_hunt(3), sniper_training
7:18.441 kill_shot Fluffy_Pillow 32.6/120: 27% focus thrill_of_the_hunt(3), sniper_training
7:19.445 steady_shot Fluffy_Pillow 37.2/120: 31% focus thrill_of_the_hunt(3), sniper_training
7:21.234 steady_shot Fluffy_Pillow 59.2/120: 49% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
7:23.021 aimed_shot Fluffy_Pillow 81.2/120: 68% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
7:24.025 steady_shot Fluffy_Pillow 55.7/120: 46% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 926 882 882
Agility 7136 6533 6287 (1323)
Stamina 8259 7509 7509
Intellect 896 854 854
Spirit 711 711 711
Health 495540 450540 0
Focus 120 120 0
Crit 52.13% 45.94% 3403
Haste 12.12% 6.78% 515
Multistrike 34.79% 29.79% 1966
Damage / Heal Versatility 5.08% 2.08% 270
Attack Power 7850 6533 0
Mastery 12.66% 9.53% 798
Armor 1713 1713 1713

Gear

Source Slot Average Item Level: 736.00
Local Head Sinister Felborne Helmet
ilevel: 731, stats: { 230 Armor, +428 AgiInt, +642 Sta, +383 Crit, +187 Mult }
Local Neck Faulty Detonator Cord
ilevel: 736, stats: { +252 Agi, +379 Sta, +197 Crit, +139 Mult }, enchant: { +75 Crit }
Local Shoulders Pauldrons of the Savage Hunt
ilevel: 720, stats: { 203 Armor, +290 Agi, +435 Sta, +226 Haste, +160 Mult }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Hauberk of the Savage Hunt
ilevel: 720, stats: { 270 Armor, +387 Agi, +580 Sta, +312 Mastery, +202 Crit }
Local Waist Torch-Brazed Waistguard
ilevel: 730, stats: { 159 Armor, +318 AgiInt, +477 Sta, +248 Mult, +175 Crit }, gems: { +75 Crit }
Local Legs Leggings of the Savage Hunt
ilevel: 735, stats: { 253 Armor, +444 Agi, +667 Sta, +372 Crit, +220 Mult }
Local Feet Spiked Throatcrusher Boots
ilevel: 740, stats: { 203 Armor, +349 AgiInt, +524 Sta, +322 Crit, +143 Mult }
Local Wrists Bracers of Fel Empowerment
ilevel: 725, stats: { 121 Armor, +228 AgiInt, +342 Sta, +191 Mult, +113 Crit, +130 Avoidance }
Local Hands Gloves of the Savage Hunt
ilevel: 735, stats: { 180 Armor, +333 Agi, +500 Sta, +279 Mastery, +165 Haste }
Local Finger1 Serrated Demontooth Ring
ilevel: 735, stats: { +250 Agi, +375 Sta, +209 Crit, +124 Haste }, enchant: { +50 Crit }
Local Finger2 Maalus, the Blood Drinker
ilevel: 795, stats: { +437 Agi, +656 Sta, +304 Crit, +270 Vers }, enchant: { +50 Crit }
Local Trinket1 Mirror of the Blademaster
ilevel: 730, stats: { +525 Agi }
Local Trinket2 Malicious Censer
ilevel: 740, stats: { +576 Mult }
Local Back Cloak of Desperate Temerity
ilevel: 735, stats: { 94 Armor, +250 Agi, +375 Sta, +230 Crit, +102 Mult }, enchant: { +100 Crit }
Local Main Hand Felcrystal Impaler
ilevel: 735, weapon: { 1916 - 2875, 3 }, stats: { +444 Agi, +667 Sta, +384 Crit, +207 Mastery }, enchant: megawatt_filament

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Marksmanship Hunter) Lone Wolf

Profile

hunter="Mokillr"
origin="https://eu.api.battle.net/wow/character/arathor/Mokillr/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hellfire/170/121297834-avatar.jpg"
level=100
race=night_elf
timeofday=night
role=attack
position=ranged_back
professions=engineering=700/alchemy=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#YZ!2012222
talent_override=lone_wolf,if=raid_event.adds.count>=3|enemies>1
glyphs=pathfinding/deterrence/disengage/play_dead/stampede/aspect_of_the_cheetah
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=pickled_eel
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=spell_targets.multi_shot<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=spell_targets.multi_shot>=3
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/glaive_toss
actions.precombat+=/focusing_shot

# Executed every time the actor is available.

actions=auto_shot
actions+=/use_item,name=torchbrazed_waistguard
actions+=/use_item,name=maalus_the_blood_drinker
actions+=/use_item,name=mirror_of_the_blademaster
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=((buff.rapid_fire.up|buff.bloodlust.up)&(cooldown.stampede.remains<1))|target.time_to_die<=25
actions+=/chimaera_shot
actions+=/kill_shot
actions+=/rapid_fire
actions+=/stampede,if=buff.rapid_fire.up|buff.bloodlust.up|target.time_to_die<=25
actions+=/call_action_list,name=careful_aim,if=buff.careful_aim.up
actions+=/explosive_trap,if=spell_targets.explosive_trap_tick>1
actions+=/a_murder_of_crows
actions+=/dire_beast,if=cast_regen+action.aimed_shot.cast_regen<focus.deficit
actions+=/glaive_toss
actions+=/powershot,if=cast_regen<focus.deficit
actions+=/barrage
# Pool max focus for rapid fire so we can spam AimedShot with Careful Aim buff
actions+=/steady_shot,if=focus.deficit*cast_time%(14+cast_regen)>cooldown.rapid_fire.remains
actions+=/focusing_shot,if=focus.deficit*cast_time%(50+cast_regen)>cooldown.rapid_fire.remains&focus<100
# Cast a second shot for steady focus if that won't cap us.
actions+=/steady_shot,if=buff.pre_steady_focus.up&(14+cast_regen+action.aimed_shot.cast_regen)<=focus.deficit
actions+=/multishot,if=spell_targets.multi_shot>6
actions+=/aimed_shot,if=talent.focusing_shot.enabled
actions+=/aimed_shot,if=focus+cast_regen>=85
actions+=/aimed_shot,if=buff.thrill_of_the_hunt.react&focus+cast_regen>=65
# Allow FS to over-cap by 10 if we have nothing else to do
actions+=/focusing_shot,if=50+cast_regen-10<focus.deficit
actions+=/steady_shot

actions.careful_aim=glaive_toss,if=active_enemies>2
actions.careful_aim+=/powershot,if=spell_targets.powershot>1&cast_regen<focus.deficit
actions.careful_aim+=/barrage,if=spell_targets.barrage>1
actions.careful_aim+=/aimed_shot
actions.careful_aim+=/focusing_shot,if=50+cast_regen<focus.deficit
actions.careful_aim+=/steady_shot

head=sinister_felborne_helmet,id=124295,bonus_id=561/566,upgrade=2
neck=faulty_detonator_cord,id=124207,bonus_id=562/567,upgrade=2,enchant=75crit
shoulders=pauldrons_of_the_savage_hunt,id=124307,bonus_id=566,upgrade=2
back=cloak_of_desperate_temerity,id=124134,bonus_id=567,upgrade=2,enchant=gift_of_critical_strike
chest=hauberk_of_the_savage_hunt,id=124284,bonus_id=566,upgrade=2
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=bracers_of_fel_empowerment,id=124314,bonus_id=40/566,upgrade=2
hands=gloves_of_the_savage_hunt,id=124292,bonus_id=567,upgrade=2
waist=torchbrazed_waistguard,id=124309,bonus_id=565/567,upgrade=2,gems=75crit,addon=nitro_boosts
legs=leggings_of_the_savage_hunt,id=124301,bonus_id=567,upgrade=2
feet=spiked_throatcrusher_boots,id=124287,bonus_id=567,upgrade=2
finger1=serrated_demontooth_ring,id=124188,bonus_id=567,upgrade=2,enchant=50crit
finger2=maalus_the_blood_drinker,id=124636,bonus_id=641/649,enchant=50crit
trinket1=mirror_of_the_blademaster,id=124224,bonus_id=567,upgrade=2
trinket2=malicious_censer,id=124226,bonus_id=567,upgrade=2
main_hand=felcrystal_impaler,id=124362,bonus_id=567,upgrade=2,enchant=megawatt_filament

# Gear Summary
# gear_ilvl=736.13
# gear_agility=4935
# gear_stamina=6619
# gear_crit_rating=3241
# gear_haste_rating=515
# gear_mastery_rating=798
# gear_multistrike_rating=1966
# gear_versatility_rating=270
# gear_avoidance_rating=130
# gear_armor=1713
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1
summon_pet=cat

Myotan

Myotan : 104900 dps, 104900 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
104899.8 104899.8 44.0 / 0.042% 13870.0 / 13.2% 7269.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.0 13.0 Focus 0.00% 45.3 100.0% 100%
Origin https://eu.api.battle.net/wow/character/arathor/Myotan/advanced
Talents
  • 15: Crouching Tiger, Hidden Chimaera
  • 30: Binding Shot
  • 45: Iron Hawk
  • 60: Thrill of the Hunt
  • 75: Stampede
  • 90: Barrage
  • 100: Lone Wolf
  • Talent Calculator
Glyphs
  • Glyph of Liberation
  • Glyph of Chimaera Shot
  • Glyph of Animal Bond
  • Glyph of Revive Pet
  • Glyph of Aspect of the Cheetah
  • Glyph of Stampede
Professions
  • leatherworking: 700
  • skinning: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% M-Count M-Hit M-Crit M-Crit% Up%
Myotan 104900
Aimed Shot 28684 27.4% 88.9 5.01sec 145138 144489 Direct 88.9 48107 133275 123547 88.6% 0.0% 0.0% 52.0 14432 39981 88.6%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.92 88.85 0.00 0.00 1.0045 0.0000 12904999.64 19832946.82 34.93 144488.60 144488.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 46.07 88.62% 39981.21 33565 53269 40037.70 35379 46681 1841933 2830760 34.93
multistrike 5.92 11.38% 14432.10 14422 22888 14381.83 0 17573 85410 131262 34.81
hit 10.15 11.42% 48107.36 48073 76294 48108.74 48073 52105 488277 750404 34.93
crit 78.70 88.58% 133275.11 111885 177564 133491.53 123229 146498 10489380 16120521 34.93
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.focusing_shot.enabled
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals $sw2 Physical damage. Castable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
auto_shot 8495 8.1% 166.1 2.72sec 22994 9507 Direct 166.1 11194 26144 19560 56.0% 0.0% 0.0% 97.2 3359 7844 56.0%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.10 166.10 0.00 0.00 2.4186 0.0000 3819284.42 5869637.11 34.93 9506.97 9506.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 54.40 56.00% 7843.76 7069 11237 7847.47 7192 8777 426740 655832 34.93
multistrike 42.75 44.00% 3358.65 3037 4828 3360.15 3067 3880 143566 220639 34.93
hit 73.15 44.04% 11193.67 10124 16094 11198.02 10476 12392 818772 1258323 34.93
crit 92.95 55.96% 26144.03 23563 37458 26157.02 24785 27717 2430206 3734843 34.93
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 7827 7.5% 15.9 24.61sec 221479 74514 Periodic 250.9 6338 14750 11024 55.7% 0.0% 0.0% 147.2 2922 6801 55.7% 9.6%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.87 15.87 253.18 250.94 2.9723 0.1706 3514549.02 4999697.82 29.70 74514.46 74514.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 82.0 55.70% 6801.24 6746 10706 6800.69 6746 7490 557554 557554 0.00
multistrike 65.2 44.30% 2922.18 2898 4600 2921.91 2898 3249 190541 190541 0.00
hit 111.1 44.29% 6337.84 6287 9977 6337.24 6287 7055 704394 1082542 34.93
crit 139.8 55.71% 14749.79 14631 23220 14748.34 14631 16215 2062060 3169061 34.93
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
Chimaera Shot 0 (21531) 0.0% (20.5%) 44.5 10.24sec 217543 216569

Stats details: chimaera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.51 44.51 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 216569.28 216569.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.59 44.01% 0.00 0 0 0.00 0 0 0 0 0.00
crit 24.92 55.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: chimaera_shot

Static Values
  • id:53209
  • school:froststrike
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53209
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:A two-headed shot that hits your primary target and another nearby target, dealing $171454sw3 Nature or Frost damage to each target.
 
    Chimaera Shot (_frost) 10727 10.2% 0.0 0.00sec 0 0 Direct 22.2 105867 246791 184765 56.0% 0.0% 0.0% 13.0 31785 73997 56.1%  

Stats details: chimaera_shot_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 22.21 0.00 0.00 0.0000 0.0000 4824395.32 4824395.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.29 56.11% 73996.75 68092 108064 73956.04 0 108064 539654 539654 0.00
multistrike 5.70 43.89% 31784.97 29257 46432 31671.75 0 46432 181309 181309 0.00
hit 9.77 44.01% 105867.35 97523 154772 105923.25 97523 154772 1034843 1034843 0.00
crit 12.43 55.99% 246791.41 226973 360213 246876.96 226973 315799 3068589 3068589 0.00
 
 

Action details: chimaera_shot_frost

Static Values
  • id:171454
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171454
  • name:Chimaera Shot
  • school:frost
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171454sw3 Nature or Frost damage to each target.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.60
 
    Chimaera Shot (_nature) 10804 10.3% 0.0 0.00sec 0 0 Direct 22.2 106727 248581 186066 55.9% 0.0% 0.0% 13.0 32010 74567 56.1%  

Stats details: chimaera_shot_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 22.21 0.00 0.00 0.0000 0.0000 4858850.36 4858850.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.30 56.09% 74567.04 68608 108883 74512.62 0 108883 544104 544104 0.00
multistrike 5.71 43.91% 32009.59 29479 46783 31880.33 0 46783 182834 182834 0.00
hit 9.79 44.07% 106727.30 98262 155945 106758.63 0 155945 1044526 1044526 0.00
crit 12.42 55.93% 248581.47 228692 362942 248689.30 228692 329229 3087386 3087386 0.00
 
 

Action details: chimaera_shot_nature

Static Values
  • id:171457
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171457
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171454sw3 Nature or Frost damage to each target.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.65
 
Kill Shot 9904 9.4% 26.7 5.81sec 166619 165878 Direct 26.6 81647 190030 142261 55.9% 0.0% 0.0% 15.5 24500 57038 55.9%  

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.69 26.61 0.00 0.00 1.0045 0.0000 4447694.84 6835404.70 34.93 165878.30 165878.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.68 55.87% 57037.71 52703 83641 57050.32 0 83641 494895 760575 34.92
multistrike 6.85 44.13% 24499.69 22645 35938 24483.69 0 35938 167882 258008 34.91
hit 11.73 44.07% 81647.03 75483 119793 81665.53 75483 108468 957385 1471349 34.93
crit 14.88 55.93% 190030.27 175678 278803 190075.20 175678 227010 2827534 4345473 34.93
 
 

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:80.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing $sw2 Physical damage. Only usable on enemies with less than 20% health. If the target dies, the Hunter will regain {$164851s1=15}% of maximum health. If Kill Shot fails to kill the target, the cooldown is reset.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.85
 
Maalus 12003 11.4% 4.1 120.86sec 1306098 0 Direct 4.1 1306107 0 1306107 0.0% 0.0% 0.0% 0.0 0 0 0.0%  

Stats details: maalus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.13 4.13 0.00 0.00 0.0000 0.0000 5390324.01 5390324.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.13 100.00% 1306107.27 605489 2183397 1307782.47 984867 1606224 5390324 5390324 0.00
 
 

Action details: maalus

Static Values
  • id:187626
  • school:arcane
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187626
  • name:Maalus
  • school:arcane
  • tooltip:
  • description:{$@spelldesc187615=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2983344.26
  • base_dd_max:2983344.26
 
Stampede 0 (5456) 0.0% (5.2%) 2.0 361.91sec 1218298 1213444

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 1213443.76 1213443.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.rapid_fire.up|buff.bloodlust.up|target.time_to_die<=25
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:
  • description:Summons all of your pets to fight your current target for {$d=40 seconds}. While in an Arena or Battleground, these pets deal only ${100+$130201m1}% of their normal damage.
 
    melee (cat) 6529 1.0% 62.7 6.42sec 7773 6383 Direct 62.7 3925 7947 6612 66.8% 0.0% 0.0% 36.7 1177 2383 66.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.70 62.70 0.00 0.00 1.2178 0.0000 487408.50 749069.90 34.93 6382.70 6382.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.53 66.84% 2383.36 1820 2983 2386.53 1984 2921 58457 89840 34.93
multistrike 12.17 33.16% 1177.42 910 1491 1178.99 0 1491 14330 22022 34.93
hit 20.81 33.18% 3925.38 3033 4971 3929.49 3216 4770 81676 125523 34.93
crit 41.90 66.82% 7946.76 6066 9942 7957.67 6953 9146 332945 511685 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (cat1) 6528 1.0% 62.7 6.42sec 7773 6382 Direct 62.7 3922 7950 6613 66.8% 0.0% 0.0% 36.7 1177 2384 66.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.70 62.70 0.00 0.00 1.2178 0.0000 487371.94 749013.72 34.93 6382.22 6382.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.49 66.78% 2383.65 1820 2983 2386.83 1960 2900 58383 89726 34.93
multistrike 12.18 33.22% 1176.72 910 1491 1178.21 910 1491 14336 22033 34.93
hit 20.82 33.20% 3922.16 3033 4971 3926.67 3161 4971 81645 125476 34.93
crit 41.89 66.80% 7949.99 6066 9942 7960.72 7138 9095 333007 511780 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (cat2) 6530 1.0% 62.7 6.42sec 7774 6383 Direct 62.7 3924 7948 6615 66.9% 0.0% 0.0% 36.7 1177 2384 66.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.70 62.70 0.00 0.00 1.2178 0.0000 487461.88 749151.93 34.93 6383.40 6383.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.46 66.73% 2383.78 1820 2983 2386.72 1962 2983 58305 89606 34.93
multistrike 12.20 33.27% 1176.94 910 1491 1178.41 910 1491 14353 22059 34.93
hit 20.77 33.12% 3924.13 3033 4971 3929.01 3110 4863 81494 125244 34.93
crit 41.94 66.88% 7947.90 6066 9942 7958.53 7104 9144 333309 512243 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (cat3) 6525 1.0% 62.7 6.42sec 7768 6378 Direct 62.7 3924 7948 6609 66.7% 0.0% 0.0% 36.6 1178 2385 66.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.70 62.70 0.00 0.00 1.2178 0.0000 487079.77 748564.70 34.93 6378.40 6378.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.46 66.76% 2384.73 1820 2983 2387.83 1989 2893 58327 89639 34.93
multistrike 12.18 33.24% 1177.89 910 1491 1179.20 910 1491 14347 22049 34.93
hit 20.87 33.28% 3924.38 3033 4971 3928.93 3230 4971 81891 125854 34.93
crit 41.84 66.72% 7947.90 6066 9942 7958.67 7176 9269 332515 511024 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (cat4) 6527 1.0% 62.7 6.42sec 7771 6381 Direct 62.7 3923 7950 6611 66.8% 0.0% 0.0% 36.7 1178 2385 66.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.70 62.70 0.00 0.00 1.2178 0.0000 487272.99 748861.64 34.93 6380.93 6380.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.48 66.78% 2384.69 1820 2983 2387.91 1972 2926 58378 89718 34.93
multistrike 12.18 33.22% 1177.67 910 1491 1178.71 0 1491 14343 22043 34.93
hit 20.84 33.23% 3922.59 3033 4971 3927.64 3211 4822 81746 125630 34.93
crit 41.86 66.77% 7949.61 6066 9942 7960.13 7104 9024 332806 511471 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Steady Shot 6252 6.0% 142.9 3.10sec 19693 11734 Direct 142.6 8243 20586 16786 69.2% 0.0% 0.0% 83.4 2473 6175 69.3%  

Stats details: steady_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 142.93 142.65 0.00 0.00 1.6783 0.0000 2814729.84 4325795.34 34.93 11733.66 11733.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 57.79 69.27% 6175.22 5706 9056 6177.50 5737 6954 356840 548407 34.93
multistrike 25.64 30.73% 2472.89 2452 3891 2472.84 2452 2691 63404 97442 34.93
hit 43.91 30.78% 8242.63 8172 12970 8242.42 8172 8792 361964 556282 34.93
crit 98.73 69.22% 20585.85 19020 30186 20595.48 19732 21697 2032521 3123664 34.93
 
 

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.deficit*cast_time%(14+cast_regen)>cooldown.rapid_fire.remains
Spelldata
  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes $sw2 Physical damage and generates {$77443s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
pet - mirror_image_(trinket) 13789 / 4747
Felstorm 13789 4.5% 62.3 30.54sec 34262 3669 Periodic 360.1 3017 6061 4656 55.3% 1.5% 3.6% 207.5 1407 2826 56.1% 129.2%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.28 62.28 360.07 360.06 9.3391 1.6153 2133708.21 3062602.96 30.33 3668.71 3668.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 112.2 56.14% 2826.19 2331 3664 2827.09 2580 3064 316997 316997 0.00
multistrike_crit (blocked) 4.3 1.20% 2823.96 2331 3664 2778.58 0 3664 12199 12199 0.00
multistrike 87.6 43.86% 1406.67 1166 1832 1407.02 1262 1556 123265 123265 0.00
multistrike (blocked) 3.4 0.93% 1406.71 1166 1832 1355.84 0 1832 4713 4713 0.00
hit 149.7 41.58% 3051.20 2528 3973 3051.97 2803 3287 456859 702120 34.93
hit (blocked) 5.7 1.59% 2135.83 1770 2781 2129.48 0 2781 12263 26923 54.25
crit 191.9 53.28% 6128.76 5056 7947 6130.58 5739 6529 1175857 1807107 34.93
crit (blocked) 7.4 2.04% 4287.93 3539 5563 4286.34 0 5563 31555 69278 54.40
parry 5.4 1.49% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: felstorm

Static Values
  • id:184279
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184279
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $184280m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:Strikes all nearby targets within $184280A1 yards for $184280m1% weapon damage every $t1 sec for {$d=20 seconds}. The Mirror Image cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: felstorm_tick

Static Values
  • id:184280
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184280
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc184279=Strikes all nearby targets within $184280A1 yards for $184280m1% weapon damage every $t1 sec for {$d=20 seconds}. The Mirror Image cannot perform any other abilities during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.50
 
pet - cat 6529 / 1091
melee 6529 1.0% 62.7 6.42sec 7773 6383 Direct 62.7 3925 7947 6612 66.8% 0.0% 0.0% 36.7 1177 2383 66.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.70 62.70 0.00 0.00 1.2178 0.0000 487408.50 749069.90 34.93 6382.70 6382.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.53 66.84% 2383.36 1820 2983 2386.53 1984 2921 58457 89840 34.93
multistrike 12.17 33.16% 1177.42 910 1491 1178.99 0 1491 14330 22022 34.93
hit 20.81 33.18% 3925.38 3033 4971 3929.49 3216 4770 81676 125523 34.93
crit 41.90 66.82% 7946.76 6066 9942 7957.67 6953 9146 332945 511685 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - cat1 6528 / 1091
melee 6528 1.0% 62.7 6.42sec 7773 6382 Direct 62.7 3922 7950 6613 66.8% 0.0% 0.0% 36.7 1177 2384 66.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.70 62.70 0.00 0.00 1.2178 0.0000 487371.94 749013.72 34.93 6382.22 6382.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.49 66.78% 2383.65 1820 2983 2386.83 1960 2900 58383 89726 34.93
multistrike 12.18 33.22% 1176.72 910 1491 1178.21 910 1491 14336 22033 34.93
hit 20.82 33.20% 3922.16 3033 4971 3926.67 3161 4971 81645 125476 34.93
crit 41.89 66.80% 7949.99 6066 9942 7960.72 7138 9095 333007 511780 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - cat2 6530 / 1091
melee 6530 1.0% 62.7 6.42sec 7774 6383 Direct 62.7 3924 7948 6615 66.9% 0.0% 0.0% 36.7 1177 2384 66.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.70 62.70 0.00 0.00 1.2178 0.0000 487461.88 749151.93 34.93 6383.40 6383.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.46 66.73% 2383.78 1820 2983 2386.72 1962 2983 58305 89606 34.93
multistrike 12.20 33.27% 1176.94 910 1491 1178.41 910 1491 14353 22059 34.93
hit 20.77 33.12% 3924.13 3033 4971 3929.01 3110 4863 81494 125244 34.93
crit 41.94 66.88% 7947.90 6066 9942 7958.53 7104 9144 333309 512243 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - cat3 6525 / 1091
melee 6525 1.0% 62.7 6.42sec 7768 6378 Direct 62.7 3924 7948 6609 66.7% 0.0% 0.0% 36.6 1178 2385 66.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.70 62.70 0.00 0.00 1.2178 0.0000 487079.77 748564.70 34.93 6378.40 6378.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.46 66.76% 2384.73 1820 2983 2387.83 1989 2893 58327 89639 34.93
multistrike 12.18 33.24% 1177.89 910 1491 1179.20 910 1491 14347 22049 34.93
hit 20.87 33.28% 3924.38 3033 4971 3928.93 3230 4971 81891 125854 34.93
crit 41.84 66.72% 7947.90 6066 9942 7958.67 7176 9269 332515 511024 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - cat4 6527 / 1091
melee 6527 1.0% 62.7 6.42sec 7771 6381 Direct 62.7 3923 7950 6611 66.8% 0.0% 0.0% 36.7 1178 2385 66.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.70 62.70 0.00 0.00 1.2178 0.0000 487272.99 748861.64 34.93 6380.93 6380.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 24.48 66.78% 2384.69 1820 2983 2387.91 1972 2926 58378 89718 34.93
multistrike 12.18 33.22% 1177.67 910 1491 1178.71 0 1491 14343 22043 34.93
hit 20.84 33.23% 3922.59 3033 4971 3927.64 3211 4822 81746 125630 34.93
crit 41.86 66.77% 7949.61 6066 9942 7960.13 7104 9024 332806 511471 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Myotan
Burning Mirror 7.9 60.78sec

Stats details: burning_mirror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 7.95 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: burning_mirror

Static Values
  • id:184270
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:184270
  • name:Burning Mirror
  • school:arcane
  • tooltip:
  • description:Summons {$?s19574=false}[${$m1/2}][$m1] Mirror Images to attack your target and nearby enemies for {$184271d=20 seconds}.
 
Draenic Agility Potion (potion) 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: potion

Static Values
  • id:156423
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your Agility by {$s1=1000} for {$d=25 seconds}.
 
Rapid Fire 4.3 121.24sec

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases haste by $w1%.
  • description:Increases haste by {$s1=40}% for {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.03% 14.29% 0.0(0.0)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Careful Aim 11.2 0.0 41.7sec 35.8sec 31.89% 46.98% 0.0(0.0)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_careful_aim
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • careful_aim_1:31.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:34483
  • name:Careful Aim
  • tooltip:
  • description:Increases the critical strike chance of your Steady Shot, Focusing Shot, and Aimed Shot by {$s1=50}% on targets who are above {$s2=80}% health or while Rapid Fire is active.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Draenic Agility Potion 2.0 0.0 362.8sec 0.0sec 10.53% 10.54% 0.0(0.0)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:10.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your Agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Maalus 4.3 0.0 120.9sec 120.8sec 14.20% 21.53% 0.0(0.0)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_maalus
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • maalus_1:14.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187620
  • name:Maalus
  • tooltip:$?$w1>0[Damage dealt increased by $w1%. When this effect ends, the triggering ally will explode for $w1% of all damage dealt while empowered.][Contributing toward the master's Savage Hollows.]
  • description:{$@spelldesc187615=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Megawatt Filament 10.4 3.5 44.7sec 32.8sec 32.07% 32.08% 3.5(3.5)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_megawatt_filament
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:750.00

Stack Uptimes

  • megawatt_filament_1:32.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156060
  • name:Megawatt Filament
  • tooltip:Critical strike increased by $w1.
  • description:Critical strike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Rapid Fire 4.3 0.0 121.2sec 121.2sec 13.77% 17.31% 0.0(0.0)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rapid_fire_1:13.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases haste by $w1%.
  • description:Increases haste by {$s1=40}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Rapid Fire (_t18) 9.0 0.0 45.0sec 45.0sec 7.51% 23.80% 0.0(0.0)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_rapid_fire_t18
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:0.40

Stack Uptimes

  • rapid_fire_t18_1:7.51%

Trigger Attempt Success

  • trigger_pct:40.06%

Spelldata details

  • id:188202
  • name:Rapid Fire
  • tooltip:Increases haste by $w1%.
  • description:Increases haste by {$s1=40}% for {$d=4 seconds}.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Mastery: Sniper Training (sniper_training) 1.0 899.5 0.0sec 0.5sec 100.00% 100.00% 899.5(899.5)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_sniper_training
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sniper_training_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:76659
  • name:Mastery: Sniper Training
  • tooltip:
  • description:When you stand still for {$168809d=3 seconds}, you gain Sniper Training for {$s3=6} sec, which increases your damage, shot range, and critical strike damage by {$s1=0}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.9sec 361.9sec 16.74% 16.75% 0.0(0.0)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:16.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill of the Hunt 18.8 16.4 24.0sec 12.7sec 50.50% 73.02% 16.4(31.9)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_thrill_of_the_hunt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • thrill_of_the_hunt_1:12.01%
  • thrill_of_the_hunt_2:17.85%
  • thrill_of_the_hunt_3:20.64%

Trigger Attempt Success

  • trigger_pct:23.49%

Spelldata details

  • id:34720
  • name:Thrill of the Hunt
  • tooltip:Reduces the Focus cost of your next Arcane Shot, Aimed Shot, or Multi-Shot by {$s1=20}.
  • description:{$@spelldesc109306=You have a {$s1=6}% chance per 10 Focus spent on Focus-costing attacks to trigger Thrill of the Hunt. Thrill of the Hunt reduces the Focus cost of your next {$s2=3} Arcane Shots, Aimed Shots, or Multi-Shots by {$34720s1=20}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Stampede 2.0 0.0 361.9sec 361.9sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Myotan_cat
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.9sec 361.9sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Myotan_cat1
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.9sec 361.9sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Myotan_cat2
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.9sec 361.9sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Myotan_cat3
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.9sec 361.9sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Myotan_cat4
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Stance of the Fierce Tiger (fierce_tiger_movement_aura)

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_fierce_tiger_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fierce_tiger_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:
  • description:Increases all damage dealt by {$s3=10}%. Grants you and your allies within $m7 yards {$166646s1=10}% increased movement speed, and improves the functionality of Jab, Expel Harm, Tiger Palm, Blackout Kick, and Rising Sun Kick.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Draenic Agility Flask

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
pickled_eel_food

Buff details

  • buff initial source:Myotan
  • cooldown name:buff_pickled_eel_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:125.00

Stack Uptimes

  • pickled_eel_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Myotan
aimed_shot Focus 88.9 3346.9 37.6 37.6 3855.8
barrage Focus 15.9 952.1 60.0 60.0 3691.4
chimaera_shot Focus 44.5 1557.9 35.0 35.0 6215.5
Resource Gains Type Count Total Average Overflow
focus_regen Focus 905.44 2202.02 (31.11%) 2.43 0.18 0.01%
thrill_of_the_hunt_savings Focus 65.13 1302.60 (18.40%) 20.00 0.00 0.00%
steady_shot Focus 142.93 2000.26 (28.26%) 13.99 0.77 0.04%
aimed_shot Focus 78.71 1574.11 (22.24%) 20.00 0.00 0.00%
pet - cat
focus_regen Focus 135.52 0.00 (0.00%) 0.00 555.44 100.00%
pet - cat1
focus_regen Focus 135.52 0.00 (0.00%) 0.00 555.44 100.00%
pet - cat2
focus_regen Focus 135.52 0.00 (0.00%) 0.00 555.44 100.00%
pet - cat3
focus_regen Focus 135.52 0.00 (0.00%) 0.00 555.44 100.00%
pet - cat4
focus_regen Focus 135.52 0.00 (0.00%) 0.00 555.44 100.00%
Resource RPS-Gain RPS-Loss
Focus 12.84 13.02
Combat End Resource Mean Min Max
Focus 39.14 0.07 111.54

Benefits & Uptimes

Benefits %
aimed_in_careful_aim 73.8%
Uptimes %
Focus Cap 0.0%

Procs

Count Interval
starved: chimaera_shot 10.4 39.9sec
starved: barrage 69.4 6.1sec
thrill_of_the_hunt 35.1 12.7sec
tier18_2pc_mm_wasted_proc 0.6 173.8sec
tier18_2pc_mm_wasted_overwrite 4.3 121.2sec

Statistics & Data Analysis

Fight Length
Sample Data Myotan Fight Length
Count 24999
Mean 450.01
Minimum 351.82
Maximum 558.10
Spread ( max - min ) 206.27
Range [ ( max - min ) / 2 * 100% ] 22.92%
DPS
Sample Data Myotan Damage Per Second
Count 24999
Mean 104899.77
Minimum 92872.46
Maximum 119712.71
Spread ( max - min ) 26840.24
Range [ ( max - min ) / 2 * 100% ] 12.79%
Standard Deviation 3547.2576
5th Percentile 99275.85
95th Percentile 111001.62
( 95th Percentile - 5th Percentile ) 11725.77
Mean Distribution
Standard Deviation 22.4353
95.00% Confidence Intervall ( 104855.80 - 104943.75 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4392
0.1 Scale Factor Error with Delta=300 107416
0.05 Scale Factor Error with Delta=300 429664
0.01 Scale Factor Error with Delta=300 10741603
Priority Target DPS
Sample Data Myotan Priority Target Damage Per Second
Count 24999
Mean 104899.77
Minimum 92872.46
Maximum 119712.71
Spread ( max - min ) 26840.24
Range [ ( max - min ) / 2 * 100% ] 12.79%
Standard Deviation 3547.2576
5th Percentile 99275.85
95th Percentile 111001.62
( 95th Percentile - 5th Percentile ) 11725.77
Mean Distribution
Standard Deviation 22.4353
95.00% Confidence Intervall ( 104855.80 - 104943.75 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4392
0.1 Scale Factor Error with Delta=300 107416
0.05 Scale Factor Error with Delta=300 429664
0.01 Scale Factor Error with Delta=300 10741603
DPS(e)
Sample Data Myotan Damage Per Second (Effective)
Count 24999
Mean 104899.77
Minimum 92872.46
Maximum 119712.71
Spread ( max - min ) 26840.24
Range [ ( max - min ) / 2 * 100% ] 12.79%
Damage
Sample Data Myotan Damage
Count 24999
Mean 42574827.45
Minimum 30519740.08
Maximum 55433306.46
Spread ( max - min ) 24913566.38
Range [ ( max - min ) / 2 * 100% ] 29.26%
DTPS
Sample Data Myotan Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Myotan Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Myotan Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Myotan Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Myotan Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Myotan Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MyotanTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Myotan Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=pickled_eel
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=spell_targets.multi_shot<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=spell_targets.multi_shot>=3
6 0.00 potion,name=draenic_agility
7 0.00 glaive_toss
8 0.00 focusing_shot
Default action list Executed every time the actor is available.
# count action,conditions
9 1.00 auto_shot
A 4.34 use_item,name=maalus_the_blood_drinker
B 7.95 use_item,name=mirror_of_the_blademaster
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
C 1.00 potion,name=draenic_agility,if=((buff.rapid_fire.up|buff.bloodlust.up)&(cooldown.stampede.remains<1))|target.time_to_die<=25
D 44.51 chimaera_shot
E 26.69 kill_shot
F 4.32 rapid_fire
G 2.00 stampede,if=buff.rapid_fire.up|buff.bloodlust.up|target.time_to_die<=25
H 0.00 call_action_list,name=careful_aim,if=buff.careful_aim.up
0.00 explosive_trap,if=spell_targets.explosive_trap_tick>1
0.00 a_murder_of_crows
0.00 dire_beast,if=cast_regen+action.aimed_shot.cast_regen<focus.deficit
0.00 glaive_toss
0.00 powershot,if=cast_regen<focus.deficit
I 15.87 barrage
J 7.04 steady_shot,if=focus.deficit*cast_time%(14+cast_regen)>cooldown.rapid_fire.remains
Pool max focus for rapid fire so we can spam AimedShot with Careful Aim buff
0.00 focusing_shot,if=focus.deficit*cast_time%(50+cast_regen)>cooldown.rapid_fire.remains&focus<100
0.00 steady_shot,if=buff.pre_steady_focus.up&(14+cast_regen+action.aimed_shot.cast_regen)<=focus.deficit
Cast a second shot for steady focus if that won't cap us.
0.00 multishot,if=spell_targets.multi_shot>6
0.00 aimed_shot,if=talent.focusing_shot.enabled
K 8.31 aimed_shot,if=focus+cast_regen>=85
L 14.77 aimed_shot,if=buff.thrill_of_the_hunt.react&focus+cast_regen>=65
0.00 focusing_shot,if=50+cast_regen-10<focus.deficit
Allow FS to over-cap by 10 if we have nothing else to do
M 92.74 steady_shot
actions.careful_aim
# count action,conditions
0.00 glaive_toss,if=active_enemies>2
0.00 powershot,if=spell_targets.powershot>1&cast_regen<focus.deficit
0.00 barrage,if=spell_targets.barrage>1
N 65.84 aimed_shot
0.00 focusing_shot,if=50+cast_regen<focus.deficit
O 43.58 steady_shot

Sample Sequence

0169ABDFGNNNNNONODONNONONODNONNNNNODOONNNONODOONONONDOONONNDOBOMIMDMMMLMDMMKMIDMMMLLLDMNONOMDMIJJDJANFNBNNONODOONONNNODMMIMDMONOMMDMKMMIDMMMLMDMLMBMMDIMMLMDMMLMLMDMIMMDMMLMLMDMMIJDJJAFNNBNNODNONNONONDMONOMIMDMONNOMDMMKMIDEEMMLLLDMEEBMLMDMIEEMDMNNNNMEDEMMIMDEEMMLMDMEELIJDJJAEEBFCGNNDONONNEENDONNMMIEEDMMMLLMDEENNNMMDMEEIMDMMBEEMKDMMMEEIDMM

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 120.0/120: 100% focus sniper_training
Pre food Fluffy_Pillow 120.0/120: 100% focus sniper_training
Pre potion Fluffy_Pillow 120.0/120: 100% focus sniper_training, draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 120.0/120: 100% focus sniper_training, draenic_agility_potion
0:00.000 use_item_maalus_the_blood_drinker Fluffy_Pillow 120.0/120: 100% focus sniper_training, draenic_agility_potion
0:00.000 use_item_mirror_of_the_blademaster Fluffy_Pillow 120.0/120: 100% focus sniper_training, maalus, draenic_agility_potion
0:00.000 chimaera_shot Fluffy_Pillow 120.0/120: 100% focus sniper_training, maalus, draenic_agility_potion
0:01.004 rapid_fire Fluffy_Pillow 90.6/120: 75% focus bloodlust, sniper_training, maalus, megawatt_filament, draenic_agility_potion
0:01.004 stampede Fluffy_Pillow 90.6/120: 75% focus bloodlust, rapid_fire, sniper_training, maalus, megawatt_filament, draenic_agility_potion
0:02.009 aimed_shot Fluffy_Pillow 98.6/120: 82% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:03.014 aimed_shot Fluffy_Pillow 76.6/120: 64% focus bloodlust, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:04.019 aimed_shot Fluffy_Pillow 74.7/120: 62% focus bloodlust, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:05.024 aimed_shot Fluffy_Pillow 72.7/120: 61% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:06.029 aimed_shot Fluffy_Pillow 50.7/120: 42% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:07.034 steady_shot Fluffy_Pillow 28.7/120: 24% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:08.041 aimed_shot Fluffy_Pillow 50.8/120: 42% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:09.046 steady_shot Fluffy_Pillow 28.8/120: 24% focus bloodlust, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:10.053 chimaera_shot Fluffy_Pillow 50.8/120: 42% focus bloodlust, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:11.057 steady_shot Fluffy_Pillow 23.9/120: 20% focus bloodlust, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:12.064 aimed_shot Fluffy_Pillow 45.9/120: 38% focus bloodlust, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:13.069 aimed_shot Fluffy_Pillow 43.9/120: 37% focus bloodlust, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus, draenic_agility_potion
0:14.074 steady_shot Fluffy_Pillow 41.9/120: 35% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, draenic_agility_potion
0:15.082 aimed_shot Fluffy_Pillow 64.0/120: 53% focus bloodlust, rapid_fire, sniper_training, stampede, draenic_agility_potion
0:16.086 steady_shot Fluffy_Pillow 41.8/120: 35% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:17.493 aimed_shot Fluffy_Pillow 63.8/120: 53% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:18.499 steady_shot Fluffy_Pillow 39.6/120: 33% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:19.906 chimaera_shot Fluffy_Pillow 61.6/120: 51% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:20.913 aimed_shot Fluffy_Pillow 32.3/120: 27% focus bloodlust, thrill_of_the_hunt(3), sniper_training, stampede, draenic_agility_potion
0:21.917 steady_shot Fluffy_Pillow 28.1/120: 23% focus bloodlust, thrill_of_the_hunt(2), sniper_training, stampede, draenic_agility_potion
0:23.323 aimed_shot Fluffy_Pillow 50.1/120: 42% focus bloodlust, thrill_of_the_hunt(2), sniper_training, stampede
0:24.328 aimed_shot Fluffy_Pillow 45.8/120: 38% focus bloodlust, thrill_of_the_hunt, sniper_training, stampede
0:25.333 aimed_shot Fluffy_Pillow 41.6/120: 35% focus bloodlust, thrill_of_the_hunt(2), sniper_training, stampede
0:26.339 aimed_shot Fluffy_Pillow 37.3/120: 31% focus bloodlust, thrill_of_the_hunt(2), sniper_training, stampede
0:27.343 aimed_shot Fluffy_Pillow 33.0/120: 28% focus bloodlust, thrill_of_the_hunt, sniper_training, stampede
0:28.349 steady_shot Fluffy_Pillow 28.7/120: 24% focus bloodlust, sniper_training, stampede
0:29.755 chimaera_shot Fluffy_Pillow 50.8/120: 42% focus bloodlust, sniper_training, stampede
0:30.761 steady_shot Fluffy_Pillow 21.5/120: 18% focus bloodlust, sniper_training, stampede, rapid_fire_t18
0:31.766 steady_shot Fluffy_Pillow 43.5/120: 36% focus bloodlust, sniper_training, stampede, rapid_fire_t18
0:32.772 aimed_shot Fluffy_Pillow 65.6/120: 55% focus bloodlust, sniper_training, stampede, rapid_fire_t18
0:33.777 aimed_shot Fluffy_Pillow 43.6/120: 36% focus bloodlust, thrill_of_the_hunt(2), sniper_training, stampede, rapid_fire_t18
0:34.782 aimed_shot Fluffy_Pillow 41.6/120: 35% focus bloodlust, thrill_of_the_hunt, sniper_training, stampede
0:35.785 steady_shot Fluffy_Pillow 37.3/120: 31% focus bloodlust, sniper_training, stampede
0:37.193 aimed_shot Fluffy_Pillow 59.3/120: 49% focus bloodlust, sniper_training, stampede
0:38.197 steady_shot Fluffy_Pillow 35.0/120: 29% focus bloodlust, sniper_training, stampede
0:39.602 chimaera_shot Fluffy_Pillow 57.0/120: 48% focus bloodlust, sniper_training, stampede
0:40.607 steady_shot Fluffy_Pillow 27.8/120: 23% focus bloodlust, sniper_training, stampede, rapid_fire_t18
0:41.613 steady_shot Fluffy_Pillow 48.0/120: 40% focus sniper_training, rapid_fire_t18
0:42.922 aimed_shot Fluffy_Pillow 70.0/120: 58% focus sniper_training, rapid_fire_t18
0:43.926 steady_shot Fluffy_Pillow 46.2/120: 38% focus sniper_training, rapid_fire_t18
0:45.234 aimed_shot Fluffy_Pillow 67.1/120: 56% focus sniper_training
0:46.239 steady_shot Fluffy_Pillow 41.5/120: 35% focus sniper_training
0:48.065 aimed_shot Fluffy_Pillow 63.5/120: 53% focus sniper_training
0:49.071 chimaera_shot Fluffy_Pillow 37.9/120: 32% focus sniper_training
0:50.077 steady_shot Fluffy_Pillow 7.3/120: 6% focus sniper_training
0:51.905 steady_shot Fluffy_Pillow 29.4/120: 24% focus sniper_training
0:53.734 aimed_shot Fluffy_Pillow 51.4/120: 43% focus sniper_training
0:54.739 steady_shot Fluffy_Pillow 25.8/120: 21% focus thrill_of_the_hunt(2), sniper_training
0:56.566 aimed_shot Fluffy_Pillow 47.8/120: 40% focus thrill_of_the_hunt(2), sniper_training
0:57.570 aimed_shot Fluffy_Pillow 42.2/120: 35% focus thrill_of_the_hunt, sniper_training
0:58.574 chimaera_shot Fluffy_Pillow 36.6/120: 31% focus sniper_training
0:59.579 steady_shot Fluffy_Pillow 6.0/120: 5% focus thrill_of_the_hunt(3), sniper_training
1:01.406 use_item_mirror_of_the_blademaster Fluffy_Pillow 28.0/120: 23% focus thrill_of_the_hunt(3), sniper_training
1:01.406 steady_shot Fluffy_Pillow 28.0/120: 23% focus thrill_of_the_hunt(3), sniper_training
1:03.232 steady_shot Fluffy_Pillow 50.0/120: 42% focus thrill_of_the_hunt(3), sniper_training
1:05.059 barrage Fluffy_Pillow 72.1/120: 60% focus thrill_of_the_hunt(3), sniper_training
1:07.983 steady_shot Fluffy_Pillow 24.9/120: 21% focus thrill_of_the_hunt(3), sniper_training
1:09.810 chimaera_shot Fluffy_Pillow 46.9/120: 39% focus thrill_of_the_hunt(3), sniper_training
1:10.814 steady_shot Fluffy_Pillow 16.3/120: 14% focus thrill_of_the_hunt(3), sniper_training
1:12.642 steady_shot Fluffy_Pillow 38.3/120: 32% focus thrill_of_the_hunt(3), sniper_training
1:14.470 steady_shot Fluffy_Pillow 60.3/120: 50% focus thrill_of_the_hunt(3), sniper_training
1:16.298 aimed_shot Fluffy_Pillow 82.4/120: 69% focus thrill_of_the_hunt(3), sniper_training
1:17.302 steady_shot Fluffy_Pillow 56.8/120: 47% focus thrill_of_the_hunt(2), sniper_training
1:19.131 chimaera_shot Fluffy_Pillow 78.8/120: 66% focus thrill_of_the_hunt(2), sniper_training
1:20.135 steady_shot Fluffy_Pillow 48.2/120: 40% focus sniper_training
1:21.963 steady_shot Fluffy_Pillow 70.2/120: 59% focus sniper_training
1:23.791 aimed_shot Fluffy_Pillow 92.2/120: 77% focus sniper_training
1:24.795 steady_shot Fluffy_Pillow 66.6/120: 56% focus sniper_training
1:26.623 barrage Fluffy_Pillow 88.7/120: 74% focus thrill_of_the_hunt(3), sniper_training
1:29.659 chimaera_shot Fluffy_Pillow 42.0/120: 35% focus thrill_of_the_hunt(3), sniper_training
1:30.665 steady_shot Fluffy_Pillow 11.4/120: 9% focus thrill_of_the_hunt(3), sniper_training
1:32.492 steady_shot Fluffy_Pillow 33.4/120: 28% focus thrill_of_the_hunt(3), sniper_training
1:34.320 steady_shot Fluffy_Pillow 55.4/120: 46% focus thrill_of_the_hunt(3), sniper_training
1:36.148 aimed_shot Fluffy_Pillow 77.4/120: 65% focus thrill_of_the_hunt(3), sniper_training
1:37.153 aimed_shot Fluffy_Pillow 71.8/120: 60% focus thrill_of_the_hunt(2), sniper_training
1:38.156 aimed_shot Fluffy_Pillow 66.2/120: 55% focus thrill_of_the_hunt(2), sniper_training
1:39.160 chimaera_shot Fluffy_Pillow 60.7/120: 51% focus thrill_of_the_hunt, sniper_training
1:40.165 steady_shot Fluffy_Pillow 30.1/120: 25% focus thrill_of_the_hunt, sniper_training, rapid_fire_t18
1:41.470 aimed_shot Fluffy_Pillow 52.1/120: 43% focus careful_aim, thrill_of_the_hunt, sniper_training, rapid_fire_t18, megawatt_filament
1:42.475 steady_shot Fluffy_Pillow 48.3/120: 40% focus careful_aim, sniper_training, rapid_fire_t18, megawatt_filament
1:43.782 aimed_shot Fluffy_Pillow 70.3/120: 59% focus careful_aim, sniper_training, rapid_fire_t18, megawatt_filament
1:44.787 steady_shot Fluffy_Pillow 45.4/120: 38% focus careful_aim, sniper_training, megawatt_filament
1:46.615 steady_shot Fluffy_Pillow 67.4/120: 56% focus sniper_training, megawatt_filament
1:48.441 chimaera_shot Fluffy_Pillow 89.4/120: 74% focus sniper_training, megawatt_filament
1:49.445 steady_shot Fluffy_Pillow 58.8/120: 49% focus sniper_training, megawatt_filament
1:51.273 barrage Fluffy_Pillow 80.8/120: 67% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
1:54.227 steady_shot Fluffy_Pillow 33.8/120: 28% focus thrill_of_the_hunt(3), sniper_training
1:56.054 steady_shot Fluffy_Pillow 55.8/120: 46% focus thrill_of_the_hunt(3), sniper_training
1:57.882 chimaera_shot Fluffy_Pillow 77.8/120: 65% focus thrill_of_the_hunt(3), sniper_training
1:58.888 steady_shot Fluffy_Pillow 47.2/120: 39% focus thrill_of_the_hunt(3), sniper_training, rapid_fire_t18
2:00.193 use_item_maalus_the_blood_drinker Fluffy_Pillow 69.2/120: 58% focus careful_aim, thrill_of_the_hunt(3), sniper_training, rapid_fire_t18, megawatt_filament
2:00.193 aimed_shot Fluffy_Pillow 69.2/120: 58% focus careful_aim, thrill_of_the_hunt(3), sniper_training, rapid_fire_t18, maalus, megawatt_filament
2:01.197 rapid_fire Fluffy_Pillow 65.4/120: 55% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, maalus, megawatt_filament
2:01.197 aimed_shot Fluffy_Pillow 65.4/120: 55% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
2:02.201 use_item_mirror_of_the_blademaster Fluffy_Pillow 61.6/120: 51% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, maalus, megawatt_filament
2:02.201 aimed_shot Fluffy_Pillow 61.6/120: 51% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, maalus, megawatt_filament
2:03.206 aimed_shot Fluffy_Pillow 57.7/120: 48% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:04.208 steady_shot Fluffy_Pillow 33.9/120: 28% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:05.516 aimed_shot Fluffy_Pillow 55.9/120: 47% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:06.523 steady_shot Fluffy_Pillow 32.1/120: 27% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:07.828 chimaera_shot Fluffy_Pillow 54.1/120: 45% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:08.832 steady_shot Fluffy_Pillow 25.3/120: 21% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:10.138 steady_shot Fluffy_Pillow 47.3/120: 39% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:11.444 aimed_shot Fluffy_Pillow 69.3/120: 58% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:12.448 steady_shot Fluffy_Pillow 45.5/120: 38% focus careful_aim, rapid_fire, sniper_training, maalus
2:13.755 aimed_shot Fluffy_Pillow 67.5/120: 56% focus careful_aim, rapid_fire, sniper_training, maalus
2:14.759 aimed_shot Fluffy_Pillow 43.7/120: 36% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus
2:15.764 aimed_shot Fluffy_Pillow 39.9/120: 33% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training
2:16.770 steady_shot Fluffy_Pillow 35.0/120: 29% focus careful_aim, sniper_training
2:18.599 chimaera_shot Fluffy_Pillow 57.1/120: 48% focus sniper_training
2:19.604 steady_shot Fluffy_Pillow 26.5/120: 22% focus sniper_training
2:21.433 steady_shot Fluffy_Pillow 48.5/120: 40% focus sniper_training
2:23.260 barrage Fluffy_Pillow 70.5/120: 59% focus sniper_training
2:26.177 steady_shot Fluffy_Pillow 23.3/120: 19% focus sniper_training
2:28.005 chimaera_shot Fluffy_Pillow 45.3/120: 38% focus sniper_training
2:29.013 steady_shot Fluffy_Pillow 14.8/120: 12% focus sniper_training, rapid_fire_t18
2:30.321 steady_shot Fluffy_Pillow 36.8/120: 31% focus careful_aim, sniper_training, rapid_fire_t18
2:31.628 aimed_shot Fluffy_Pillow 58.8/120: 49% focus careful_aim, sniper_training, rapid_fire_t18
2:32.630 steady_shot Fluffy_Pillow 35.0/120: 29% focus careful_aim, sniper_training, rapid_fire_t18
2:33.935 steady_shot Fluffy_Pillow 55.3/120: 46% focus sniper_training
2:35.762 steady_shot Fluffy_Pillow 77.4/120: 64% focus sniper_training
2:37.589 chimaera_shot Fluffy_Pillow 99.4/120: 83% focus sniper_training
2:38.594 steady_shot Fluffy_Pillow 68.8/120: 57% focus sniper_training
2:40.421 aimed_shot Fluffy_Pillow 90.8/120: 76% focus sniper_training
2:41.426 steady_shot Fluffy_Pillow 45.2/120: 38% focus sniper_training
2:43.253 steady_shot Fluffy_Pillow 67.2/120: 56% focus sniper_training
2:45.080 barrage Fluffy_Pillow 89.2/120: 74% focus sniper_training
2:48.176 chimaera_shot Fluffy_Pillow 42.8/120: 36% focus sniper_training
2:49.181 steady_shot Fluffy_Pillow 12.2/120: 10% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
2:51.010 steady_shot Fluffy_Pillow 34.3/120: 29% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
2:52.837 steady_shot Fluffy_Pillow 56.3/120: 47% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
2:54.665 aimed_shot Fluffy_Pillow 78.3/120: 65% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
2:55.670 steady_shot Fluffy_Pillow 52.7/120: 44% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
2:57.497 chimaera_shot Fluffy_Pillow 74.7/120: 62% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
2:58.502 steady_shot Fluffy_Pillow 44.1/120: 37% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
3:00.329 aimed_shot Fluffy_Pillow 66.1/120: 55% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
3:01.333 steady_shot Fluffy_Pillow 40.5/120: 34% focus thrill_of_the_hunt, sniper_training
3:03.161 use_item_mirror_of_the_blademaster Fluffy_Pillow 62.6/120: 52% focus thrill_of_the_hunt, sniper_training
3:03.161 steady_shot Fluffy_Pillow 62.6/120: 52% focus thrill_of_the_hunt, sniper_training
3:04.986 steady_shot Fluffy_Pillow 84.6/120: 70% focus sniper_training
3:06.813 chimaera_shot Fluffy_Pillow 106.6/120: 89% focus sniper_training
3:07.817 barrage Fluffy_Pillow 76.0/120: 63% focus thrill_of_the_hunt(3), sniper_training
3:10.815 steady_shot Fluffy_Pillow 29.1/120: 24% focus thrill_of_the_hunt(3), sniper_training
3:12.642 steady_shot Fluffy_Pillow 51.1/120: 43% focus thrill_of_the_hunt(3), sniper_training
3:14.469 aimed_shot Fluffy_Pillow 73.2/120: 61% focus thrill_of_the_hunt(3), sniper_training
3:15.472 steady_shot Fluffy_Pillow 47.6/120: 40% focus thrill_of_the_hunt(2), sniper_training
3:17.298 chimaera_shot Fluffy_Pillow 69.6/120: 58% focus thrill_of_the_hunt(2), sniper_training
3:18.302 steady_shot Fluffy_Pillow 39.0/120: 32% focus thrill_of_the_hunt(3), sniper_training
3:20.131 steady_shot Fluffy_Pillow 61.0/120: 51% focus thrill_of_the_hunt(3), sniper_training
3:21.961 aimed_shot Fluffy_Pillow 83.0/120: 69% focus thrill_of_the_hunt(3), sniper_training
3:22.967 steady_shot Fluffy_Pillow 57.4/120: 48% focus thrill_of_the_hunt(2), sniper_training
3:24.795 aimed_shot Fluffy_Pillow 79.5/120: 66% focus thrill_of_the_hunt(2), sniper_training
3:25.801 steady_shot Fluffy_Pillow 53.9/120: 45% focus thrill_of_the_hunt, sniper_training
3:27.628 chimaera_shot Fluffy_Pillow 75.9/120: 63% focus thrill_of_the_hunt, sniper_training
3:28.632 steady_shot Fluffy_Pillow 45.3/120: 38% focus thrill_of_the_hunt(3), sniper_training
3:30.460 barrage Fluffy_Pillow 67.3/120: 56% focus thrill_of_the_hunt(3), sniper_training
3:33.497 steady_shot Fluffy_Pillow 20.6/120: 17% focus thrill_of_the_hunt(3), sniper_training
3:35.324 steady_shot Fluffy_Pillow 42.6/120: 36% focus thrill_of_the_hunt(3), sniper_training
3:37.152 chimaera_shot Fluffy_Pillow 64.7/120: 54% focus thrill_of_the_hunt(3), sniper_training
3:38.156 steady_shot Fluffy_Pillow 34.1/120: 28% focus thrill_of_the_hunt(3), sniper_training
3:39.984 steady_shot Fluffy_Pillow 56.1/120: 47% focus thrill_of_the_hunt(3), sniper_training
3:41.812 aimed_shot Fluffy_Pillow 78.1/120: 65% focus thrill_of_the_hunt(3), sniper_training
3:42.816 steady_shot Fluffy_Pillow 52.5/120: 44% focus thrill_of_the_hunt(2), sniper_training
3:44.644 aimed_shot Fluffy_Pillow 74.5/120: 62% focus thrill_of_the_hunt(2), sniper_training
3:45.649 steady_shot Fluffy_Pillow 48.9/120: 41% focus thrill_of_the_hunt, sniper_training
3:47.474 chimaera_shot Fluffy_Pillow 70.9/120: 59% focus thrill_of_the_hunt, sniper_training
3:48.479 steady_shot Fluffy_Pillow 40.3/120: 34% focus thrill_of_the_hunt(3), sniper_training
3:50.306 steady_shot Fluffy_Pillow 62.4/120: 52% focus thrill_of_the_hunt(3), sniper_training
3:52.134 barrage Fluffy_Pillow 84.4/120: 70% focus thrill_of_the_hunt(3), sniper_training
3:55.056 steady_shot Fluffy_Pillow 37.2/120: 31% focus thrill_of_the_hunt(3), sniper_training
3:56.884 chimaera_shot Fluffy_Pillow 59.2/120: 49% focus thrill_of_the_hunt(3), sniper_training
3:57.888 steady_shot Fluffy_Pillow 28.6/120: 24% focus thrill_of_the_hunt(3), sniper_training
3:59.715 steady_shot Fluffy_Pillow 50.6/120: 42% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:01.543 use_item_maalus_the_blood_drinker Fluffy_Pillow 72.7/120: 61% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:01.543 rapid_fire Fluffy_Pillow 72.7/120: 61% focus thrill_of_the_hunt(3), sniper_training, maalus, megawatt_filament
4:01.543 aimed_shot Fluffy_Pillow 72.7/120: 61% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, maalus, megawatt_filament
4:02.546 aimed_shot Fluffy_Pillow 68.8/120: 57% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
4:03.550 use_item_mirror_of_the_blademaster Fluffy_Pillow 45.0/120: 37% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
4:03.550 aimed_shot Fluffy_Pillow 45.0/120: 37% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
4:04.555 aimed_shot Fluffy_Pillow 41.2/120: 34% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, maalus, megawatt_filament
4:05.560 steady_shot Fluffy_Pillow 37.3/120: 31% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
4:06.866 chimaera_shot Fluffy_Pillow 59.3/120: 49% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
4:07.869 aimed_shot Fluffy_Pillow 30.5/120: 25% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, maalus, megawatt_filament
4:08.874 steady_shot Fluffy_Pillow 26.7/120: 22% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
4:10.181 aimed_shot Fluffy_Pillow 48.7/120: 41% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
4:11.186 aimed_shot Fluffy_Pillow 44.9/120: 37% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, maalus, megawatt_filament
4:12.192 steady_shot Fluffy_Pillow 41.1/120: 34% focus careful_aim, rapid_fire, sniper_training, maalus
4:13.499 aimed_shot Fluffy_Pillow 63.1/120: 53% focus careful_aim, rapid_fire, sniper_training, maalus
4:14.502 steady_shot Fluffy_Pillow 39.2/120: 33% focus careful_aim, rapid_fire, sniper_training, maalus
4:15.807 aimed_shot Fluffy_Pillow 61.3/120: 51% focus careful_aim, rapid_fire, sniper_training, maalus
4:16.812 chimaera_shot Fluffy_Pillow 37.0/120: 31% focus careful_aim, sniper_training
4:17.816 steady_shot Fluffy_Pillow 6.4/120: 5% focus sniper_training, rapid_fire_t18
4:19.123 steady_shot Fluffy_Pillow 28.4/120: 24% focus careful_aim, sniper_training, rapid_fire_t18
4:20.429 aimed_shot Fluffy_Pillow 50.4/120: 42% focus careful_aim, sniper_training, rapid_fire_t18
4:21.434 steady_shot Fluffy_Pillow 26.6/120: 22% focus careful_aim, sniper_training, rapid_fire_t18
4:22.740 steady_shot Fluffy_Pillow 47.0/120: 39% focus sniper_training
4:24.567 barrage Fluffy_Pillow 69.0/120: 57% focus sniper_training
4:27.555 steady_shot Fluffy_Pillow 22.1/120: 18% focus sniper_training
4:29.384 chimaera_shot Fluffy_Pillow 44.1/120: 37% focus sniper_training
4:30.389 steady_shot Fluffy_Pillow 13.5/120: 11% focus sniper_training, rapid_fire_t18
4:31.696 steady_shot Fluffy_Pillow 35.6/120: 30% focus careful_aim, sniper_training, rapid_fire_t18, megawatt_filament
4:33.001 aimed_shot Fluffy_Pillow 57.6/120: 48% focus careful_aim, sniper_training, rapid_fire_t18, megawatt_filament
4:34.006 aimed_shot Fluffy_Pillow 33.8/120: 28% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, megawatt_filament
4:35.010 steady_shot Fluffy_Pillow 28.8/120: 24% focus careful_aim, thrill_of_the_hunt, sniper_training, megawatt_filament
4:36.838 steady_shot Fluffy_Pillow 50.8/120: 42% focus thrill_of_the_hunt, sniper_training, megawatt_filament
4:38.664 chimaera_shot Fluffy_Pillow 72.9/120: 61% focus thrill_of_the_hunt, sniper_training, megawatt_filament
4:39.669 steady_shot Fluffy_Pillow 42.3/120: 35% focus thrill_of_the_hunt, sniper_training, megawatt_filament
4:41.496 steady_shot Fluffy_Pillow 64.3/120: 54% focus thrill_of_the_hunt, sniper_training, megawatt_filament
4:43.324 aimed_shot Fluffy_Pillow 86.3/120: 72% focus thrill_of_the_hunt, sniper_training, megawatt_filament
4:44.328 steady_shot Fluffy_Pillow 80.7/120: 67% focus sniper_training
4:46.155 barrage Fluffy_Pillow 102.7/120: 86% focus thrill_of_the_hunt(3), sniper_training
4:49.260 chimaera_shot Fluffy_Pillow 56.3/120: 47% focus thrill_of_the_hunt(3), sniper_training
4:50.264 kill_shot Fluffy_Pillow 25.7/120: 21% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:51.269 kill_shot Fluffy_Pillow 30.1/120: 25% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:52.273 steady_shot Fluffy_Pillow 34.5/120: 29% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:54.102 steady_shot Fluffy_Pillow 56.6/120: 47% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:55.929 aimed_shot Fluffy_Pillow 78.6/120: 65% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:56.933 aimed_shot Fluffy_Pillow 73.0/120: 61% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
4:57.938 aimed_shot Fluffy_Pillow 67.4/120: 56% focus thrill_of_the_hunt, sniper_training, megawatt_filament
4:58.942 chimaera_shot Fluffy_Pillow 61.8/120: 52% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
4:59.946 steady_shot Fluffy_Pillow 31.2/120: 26% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
5:01.773 kill_shot Fluffy_Pillow 53.2/120: 44% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
5:02.777 kill_shot Fluffy_Pillow 57.6/120: 48% focus thrill_of_the_hunt(2), sniper_training
5:03.782 use_item_mirror_of_the_blademaster Fluffy_Pillow 62.0/120: 52% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
5:03.782 steady_shot Fluffy_Pillow 62.0/120: 52% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
5:05.609 aimed_shot Fluffy_Pillow 84.1/120: 70% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
5:06.613 steady_shot Fluffy_Pillow 58.5/120: 49% focus thrill_of_the_hunt, sniper_training, megawatt_filament
5:08.440 chimaera_shot Fluffy_Pillow 80.5/120: 67% focus thrill_of_the_hunt, sniper_training, megawatt_filament
5:09.444 steady_shot Fluffy_Pillow 49.9/120: 42% focus thrill_of_the_hunt, sniper_training, megawatt_filament
5:11.272 barrage Fluffy_Pillow 71.9/120: 60% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:14.210 kill_shot Fluffy_Pillow 24.8/120: 21% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:15.215 kill_shot Fluffy_Pillow 29.2/120: 24% focus thrill_of_the_hunt(3), sniper_training
5:16.219 steady_shot Fluffy_Pillow 33.6/120: 28% focus thrill_of_the_hunt(3), sniper_training
5:18.046 chimaera_shot Fluffy_Pillow 55.6/120: 46% focus thrill_of_the_hunt(3), sniper_training
5:19.053 steady_shot Fluffy_Pillow 25.0/120: 21% focus thrill_of_the_hunt(3), sniper_training, rapid_fire_t18
5:20.360 aimed_shot Fluffy_Pillow 47.1/120: 39% focus careful_aim, thrill_of_the_hunt(3), sniper_training, rapid_fire_t18
5:21.366 aimed_shot Fluffy_Pillow 43.2/120: 36% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18
5:22.370 aimed_shot Fluffy_Pillow 39.4/120: 33% focus careful_aim, thrill_of_the_hunt, sniper_training, rapid_fire_t18
5:23.375 aimed_shot Fluffy_Pillow 35.0/120: 29% focus careful_aim, thrill_of_the_hunt(2), sniper_training
5:24.380 steady_shot Fluffy_Pillow 29.4/120: 25% focus thrill_of_the_hunt, sniper_training
5:26.208 kill_shot Fluffy_Pillow 51.4/120: 43% focus thrill_of_the_hunt, sniper_training
5:27.213 chimaera_shot Fluffy_Pillow 55.8/120: 47% focus thrill_of_the_hunt, sniper_training
5:28.218 kill_shot Fluffy_Pillow 25.2/120: 21% focus thrill_of_the_hunt, sniper_training
5:29.223 steady_shot Fluffy_Pillow 29.7/120: 25% focus thrill_of_the_hunt, sniper_training
5:31.050 steady_shot Fluffy_Pillow 51.7/120: 43% focus thrill_of_the_hunt, sniper_training
5:32.878 barrage Fluffy_Pillow 73.7/120: 61% focus thrill_of_the_hunt(3), sniper_training
5:35.932 steady_shot Fluffy_Pillow 27.1/120: 23% focus thrill_of_the_hunt(3), sniper_training
5:37.760 chimaera_shot Fluffy_Pillow 49.1/120: 41% focus thrill_of_the_hunt(3), sniper_training
5:38.766 kill_shot Fluffy_Pillow 18.5/120: 15% focus thrill_of_the_hunt(3), sniper_training
5:39.772 kill_shot Fluffy_Pillow 22.9/120: 19% focus thrill_of_the_hunt(3), sniper_training
5:40.776 steady_shot Fluffy_Pillow 27.3/120: 23% focus thrill_of_the_hunt(3), sniper_training
5:42.603 steady_shot Fluffy_Pillow 49.3/120: 41% focus thrill_of_the_hunt(3), sniper_training
5:44.432 aimed_shot Fluffy_Pillow 71.4/120: 59% focus thrill_of_the_hunt(3), sniper_training
5:45.437 steady_shot Fluffy_Pillow 45.8/120: 38% focus thrill_of_the_hunt(2), sniper_training
5:47.265 chimaera_shot Fluffy_Pillow 67.8/120: 56% focus thrill_of_the_hunt(2), sniper_training
5:48.270 steady_shot Fluffy_Pillow 37.2/120: 31% focus thrill_of_the_hunt(2), sniper_training
5:50.099 kill_shot Fluffy_Pillow 59.2/120: 49% focus thrill_of_the_hunt(2), sniper_training
5:51.102 kill_shot Fluffy_Pillow 63.6/120: 53% focus thrill_of_the_hunt(2), sniper_training
5:52.107 aimed_shot Fluffy_Pillow 68.0/120: 57% focus thrill_of_the_hunt(2), sniper_training
5:53.112 barrage Fluffy_Pillow 62.4/120: 52% focus sniper_training
5:56.196 steady_shot Fluffy_Pillow 16.0/120: 13% focus sniper_training
5:58.023 chimaera_shot Fluffy_Pillow 38.0/120: 32% focus sniper_training
5:59.027 steady_shot Fluffy_Pillow 7.4/120: 6% focus thrill_of_the_hunt(3), sniper_training
6:00.854 steady_shot Fluffy_Pillow 29.4/120: 25% focus thrill_of_the_hunt(3), sniper_training
6:02.682 use_item_maalus_the_blood_drinker Fluffy_Pillow 51.4/120: 43% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
6:02.682 kill_shot Fluffy_Pillow 51.4/120: 43% focus thrill_of_the_hunt(3), sniper_training, maalus, megawatt_filament
6:03.686 kill_shot Fluffy_Pillow 55.8/120: 47% focus thrill_of_the_hunt(3), sniper_training, maalus, megawatt_filament
6:04.691 use_item_mirror_of_the_blademaster Fluffy_Pillow 60.2/120: 50% focus thrill_of_the_hunt(3), sniper_training, maalus, megawatt_filament
6:04.691 rapid_fire Fluffy_Pillow 60.2/120: 50% focus thrill_of_the_hunt(3), sniper_training, maalus, megawatt_filament
6:04.691 potion Fluffy_Pillow 60.2/120: 50% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, maalus, megawatt_filament
6:04.691 stampede Fluffy_Pillow 60.2/120: 50% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, maalus, megawatt_filament, draenic_agility_potion
6:05.695 aimed_shot Fluffy_Pillow 66.4/120: 55% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
6:06.700 aimed_shot Fluffy_Pillow 62.6/120: 52% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
6:07.703 chimaera_shot Fluffy_Pillow 58.7/120: 49% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
6:08.707 steady_shot Fluffy_Pillow 29.9/120: 25% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
6:10.013 aimed_shot Fluffy_Pillow 51.9/120: 43% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
6:11.017 steady_shot Fluffy_Pillow 48.1/120: 40% focus careful_aim, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
6:12.323 aimed_shot Fluffy_Pillow 70.1/120: 58% focus careful_aim, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
6:13.327 aimed_shot Fluffy_Pillow 46.3/120: 39% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
6:14.330 kill_shot Fluffy_Pillow 42.4/120: 35% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
6:15.334 kill_shot Fluffy_Pillow 48.6/120: 41% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus, draenic_agility_potion
6:16.339 aimed_shot Fluffy_Pillow 54.8/120: 46% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus, draenic_agility_potion
6:17.343 chimaera_shot Fluffy_Pillow 50.9/120: 42% focus careful_aim, rapid_fire, sniper_training, stampede, maalus, draenic_agility_potion
6:18.346 steady_shot Fluffy_Pillow 22.1/120: 18% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, stampede, draenic_agility_potion
6:19.653 aimed_shot Fluffy_Pillow 44.1/120: 37% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, stampede, draenic_agility_potion
6:20.657 aimed_shot Fluffy_Pillow 38.6/120: 32% focus careful_aim, thrill_of_the_hunt(2), sniper_training, stampede, draenic_agility_potion
6:21.660 steady_shot Fluffy_Pillow 33.0/120: 27% focus thrill_of_the_hunt(2), sniper_training, stampede, draenic_agility_potion
6:23.488 steady_shot Fluffy_Pillow 55.0/120: 46% focus thrill_of_the_hunt(2), sniper_training, stampede, draenic_agility_potion
6:25.315 barrage Fluffy_Pillow 77.0/120: 64% focus thrill_of_the_hunt(3), sniper_training, stampede, draenic_agility_potion
6:28.262 kill_shot Fluffy_Pillow 30.0/120: 25% focus thrill_of_the_hunt(3), sniper_training, stampede, draenic_agility_potion
6:29.266 kill_shot Fluffy_Pillow 34.4/120: 29% focus thrill_of_the_hunt(3), sniper_training, stampede, megawatt_filament, draenic_agility_potion
6:30.271 chimaera_shot Fluffy_Pillow 38.8/120: 32% focus thrill_of_the_hunt(3), sniper_training, stampede, megawatt_filament
6:31.275 steady_shot Fluffy_Pillow 8.2/120: 7% focus thrill_of_the_hunt(3), sniper_training, stampede, megawatt_filament
6:33.103 steady_shot Fluffy_Pillow 30.2/120: 25% focus thrill_of_the_hunt(3), sniper_training, stampede, megawatt_filament
6:34.932 steady_shot Fluffy_Pillow 52.2/120: 44% focus thrill_of_the_hunt(3), sniper_training, stampede, megawatt_filament
6:36.760 aimed_shot Fluffy_Pillow 74.2/120: 62% focus thrill_of_the_hunt(3), sniper_training, stampede, megawatt_filament
6:37.764 aimed_shot Fluffy_Pillow 68.6/120: 57% focus thrill_of_the_hunt(2), sniper_training, stampede, megawatt_filament
6:38.768 steady_shot Fluffy_Pillow 43.0/120: 36% focus thrill_of_the_hunt(2), sniper_training, stampede, megawatt_filament
6:40.594 chimaera_shot Fluffy_Pillow 65.1/120: 54% focus thrill_of_the_hunt(2), sniper_training, stampede
6:41.599 kill_shot Fluffy_Pillow 34.5/120: 29% focus thrill_of_the_hunt(3), sniper_training, stampede, rapid_fire_t18
6:42.604 kill_shot Fluffy_Pillow 40.6/120: 34% focus careful_aim, thrill_of_the_hunt(3), sniper_training, stampede, rapid_fire_t18
6:43.607 aimed_shot Fluffy_Pillow 46.8/120: 39% focus careful_aim, thrill_of_the_hunt(3), sniper_training, stampede, rapid_fire_t18, megawatt_filament
6:44.612 aimed_shot Fluffy_Pillow 43.0/120: 36% focus careful_aim, thrill_of_the_hunt(2), sniper_training, stampede, rapid_fire_t18, megawatt_filament
6:45.617 aimed_shot Fluffy_Pillow 39.1/120: 33% focus careful_aim, thrill_of_the_hunt, sniper_training, megawatt_filament
6:46.623 steady_shot Fluffy_Pillow 33.5/120: 28% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
6:48.450 steady_shot Fluffy_Pillow 55.5/120: 46% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
6:50.276 chimaera_shot Fluffy_Pillow 77.5/120: 65% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
6:51.282 steady_shot Fluffy_Pillow 47.0/120: 39% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
6:53.110 kill_shot Fluffy_Pillow 69.0/120: 57% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
6:54.113 kill_shot Fluffy_Pillow 73.4/120: 61% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
6:55.117 barrage Fluffy_Pillow 77.8/120: 65% focus thrill_of_the_hunt(2), sniper_training
6:58.223 steady_shot Fluffy_Pillow 31.4/120: 26% focus thrill_of_the_hunt(2), sniper_training
7:00.050 chimaera_shot Fluffy_Pillow 53.4/120: 45% focus thrill_of_the_hunt(2), sniper_training
7:01.055 steady_shot Fluffy_Pillow 22.8/120: 19% focus sniper_training
7:02.883 steady_shot Fluffy_Pillow 44.8/120: 37% focus sniper_training
7:04.711 use_item_mirror_of_the_blademaster Fluffy_Pillow 66.9/120: 56% focus sniper_training
7:04.711 kill_shot Fluffy_Pillow 66.9/120: 56% focus sniper_training
7:05.715 kill_shot Fluffy_Pillow 71.3/120: 59% focus sniper_training
7:06.720 steady_shot Fluffy_Pillow 75.7/120: 63% focus sniper_training
7:08.548 aimed_shot Fluffy_Pillow 97.7/120: 81% focus sniper_training
7:09.553 chimaera_shot Fluffy_Pillow 52.1/120: 43% focus sniper_training
7:10.557 steady_shot Fluffy_Pillow 21.5/120: 18% focus sniper_training
7:12.383 steady_shot Fluffy_Pillow 43.5/120: 36% focus sniper_training
7:14.209 steady_shot Fluffy_Pillow 65.5/120: 55% focus sniper_training
7:16.037 kill_shot Fluffy_Pillow 87.6/120: 73% focus sniper_training
7:17.042 kill_shot Fluffy_Pillow 92.0/120: 77% focus sniper_training
7:18.047 barrage Fluffy_Pillow 96.4/120: 80% focus sniper_training
7:20.982 chimaera_shot Fluffy_Pillow 49.2/120: 41% focus sniper_training
7:21.986 steady_shot Fluffy_Pillow 18.6/120: 16% focus sniper_training
7:23.813 steady_shot Fluffy_Pillow 40.7/120: 34% focus sniper_training

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 999 952 952
Agility 7841 7205 6930 (1407)
Stamina 8520 7746 7746
Intellect 964 919 919
Spirit 713 713 713
Health 511200 464760 0
Focus 120 120 0
Crit 56.66% 50.47% 3902
Haste 9.67% 4.44% 400
Multistrike 29.24% 24.24% 1600
Damage / Heal Versatility 5.08% 2.08% 270
Attack Power 8625 7205 0
Mastery 16.37% 13.24% 1451
Armor 1761 1761 1761

Gear

Source Slot Average Item Level: 739.00
Local Head Hood of the Savage Hunt
ilevel: 735, stats: { 235 Armor, +444 Agi, +667 Sta, +346 Mult, +245 Mastery }
Local Neck Faulty Detonator Cord
ilevel: 730, stats: { +238 Agi, +357 Sta, +186 Crit, +131 Mult }, gems: { +75 Crit }, enchant: { +75 Crit }
Local Shoulders Pauldrons of the Savage Hunt
ilevel: 720, stats: { 203 Armor, +290 Agi, +435 Sta, +226 Haste, +160 Mult }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Vestment of Illusory Might
ilevel: 741, stats: { 297 Armor, +470 AgiInt, +704 Sta, +447 Crit, +179 Mastery }, gems: { +75 Crit }
Local Waist Torch-Brazed Waistguard
ilevel: 730, stats: { 159 Armor, +318 AgiInt, +477 Sta, +248 Mult, +175 Crit }
Local Legs Leggings of the Savage Hunt
ilevel: 735, stats: { 253 Armor, +444 Agi, +667 Sta, +372 Crit, +220 Mult }
Local Feet Spiked Throatcrusher Boots
ilevel: 746, stats: { 209 Armor, +369 AgiInt, +554 Sta, +340 Crit, +151 Mult }, gems: { +75 Crit }
Local Wrists Chain Wristguards of the Stricken
ilevel: 735, stats: { 126 Armor, +250 AgiInt, +375 Sta, +202 Crit, +131 Mastery }
Local Hands Gloves of the Savage Hunt
ilevel: 741, stats: { 185 Armor, +352 Agi, +529 Sta, +295 Mastery, +174 Haste, +201 Avoidance }
Local Finger1 Portal Key Signet
ilevel: 740, stats: { +262 Agi, +393 Sta, +242 Mult, +107 Crit }, enchant: { +50 Crit }
Local Finger2 Maalus, the Blood Drinker
ilevel: 795, stats: { +437 Agi, +656 Sta, +304 Crit, +270 Vers }, enchant: { +50 Crit }
Local Trinket1 Fel-Spring Coil
ilevel: 730, stats: { +394 Agi, +394 Mastery, +394 Crit }
Local Trinket2 Mirror of the Blademaster
ilevel: 736, stats: { +555 Agi }
Local Back Cloak of Desperate Temerity
ilevel: 735, stats: { 94 Armor, +250 Agi, +375 Sta, +230 Crit, +102 Mult }, enchant: { +100 Crit }
Local Main Hand Felcrystal Impaler
ilevel: 735, weapon: { 1916 - 2875, 3 }, stats: { +444 Agi, +667 Sta, +384 Crit, +207 Mastery }, gems: { +75 Crit }, enchant: megawatt_filament
Local Tabard Tabard of the Void
ilevel: 1

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Marksmanship Hunter) Lone Wolf

Profile

hunter="Myotan"
origin="https://eu.api.battle.net/wow/character/arathor/Myotan/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hellfire/6/121295366-avatar.jpg"
level=100
race=draenei
role=attack
position=ranged_back
professions=skinning=700/leatherworking=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#YZ!2012222
talent_override=lone_wolf,if=raid_event.adds.count>=3|enemies>1
glyphs=liberation/chimaera_shot/animal_bond/revive_pet/aspect_of_the_cheetah/stampede
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=pickled_eel
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=spell_targets.multi_shot<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=spell_targets.multi_shot>=3
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/glaive_toss
actions.precombat+=/focusing_shot

# Executed every time the actor is available.

actions=auto_shot
actions+=/use_item,name=maalus_the_blood_drinker
actions+=/use_item,name=mirror_of_the_blademaster
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=((buff.rapid_fire.up|buff.bloodlust.up)&(cooldown.stampede.remains<1))|target.time_to_die<=25
actions+=/chimaera_shot
actions+=/kill_shot
actions+=/rapid_fire
actions+=/stampede,if=buff.rapid_fire.up|buff.bloodlust.up|target.time_to_die<=25
actions+=/call_action_list,name=careful_aim,if=buff.careful_aim.up
actions+=/explosive_trap,if=spell_targets.explosive_trap_tick>1
actions+=/a_murder_of_crows
actions+=/dire_beast,if=cast_regen+action.aimed_shot.cast_regen<focus.deficit
actions+=/glaive_toss
actions+=/powershot,if=cast_regen<focus.deficit
actions+=/barrage
# Pool max focus for rapid fire so we can spam AimedShot with Careful Aim buff
actions+=/steady_shot,if=focus.deficit*cast_time%(14+cast_regen)>cooldown.rapid_fire.remains
actions+=/focusing_shot,if=focus.deficit*cast_time%(50+cast_regen)>cooldown.rapid_fire.remains&focus<100
# Cast a second shot for steady focus if that won't cap us.
actions+=/steady_shot,if=buff.pre_steady_focus.up&(14+cast_regen+action.aimed_shot.cast_regen)<=focus.deficit
actions+=/multishot,if=spell_targets.multi_shot>6
actions+=/aimed_shot,if=talent.focusing_shot.enabled
actions+=/aimed_shot,if=focus+cast_regen>=85
actions+=/aimed_shot,if=buff.thrill_of_the_hunt.react&focus+cast_regen>=65
# Allow FS to over-cap by 10 if we have nothing else to do
actions+=/focusing_shot,if=50+cast_regen-10<focus.deficit
actions+=/steady_shot

actions.careful_aim=glaive_toss,if=active_enemies>2
actions.careful_aim+=/powershot,if=spell_targets.powershot>1&cast_regen<focus.deficit
actions.careful_aim+=/barrage,if=spell_targets.barrage>1
actions.careful_aim+=/aimed_shot
actions.careful_aim+=/focusing_shot,if=50+cast_regen<focus.deficit
actions.careful_aim+=/steady_shot

head=hood_of_the_savage_hunt,id=124296,bonus_id=567,upgrade=2
neck=faulty_detonator_cord,id=124207,bonus_id=565/567,upgrade=2,gems=75crit,enchant=75crit
shoulders=pauldrons_of_the_savage_hunt,id=124307,bonus_id=566,upgrade=2
back=cloak_of_desperate_temerity,id=124134,bonus_id=567,upgrade=2,enchant=gift_of_critical_strike
chest=vestment_of_illusory_might,id=124282,bonus_id=562/565/567,upgrade=2,gems=75crit
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
tabard=tabard_of_the_void,id=38311
wrists=chain_wristguards_of_the_stricken,id=124313,bonus_id=567,upgrade=2
hands=gloves_of_the_savage_hunt,id=124292,bonus_id=40/562/567,upgrade=2
waist=torchbrazed_waistguard,id=124309,bonus_id=567,upgrade=2
legs=leggings_of_the_savage_hunt,id=124301,bonus_id=567,upgrade=2
feet=spiked_throatcrusher_boots,id=124287,bonus_id=562/565/567,upgrade=2,gems=75crit
finger1=portal_key_signet,id=124189,bonus_id=567,upgrade=2,enchant=50crit
finger2=maalus_the_blood_drinker,id=124636,bonus_id=641/649,enchant=50crit
trinket1=felspring_coil,id=124223,bonus_id=567,upgrade=2
trinket2=mirror_of_the_blademaster,id=124224,bonus_id=562/567,upgrade=2
main_hand=felcrystal_impaler,id=124362,bonus_id=565/567,upgrade=2,gems=75crit,enchant=megawatt_filament

# Gear Summary
# gear_ilvl=738.93
# gear_agility=5517
# gear_stamina=6856
# gear_crit_rating=3716
# gear_haste_rating=400
# gear_mastery_rating=1451
# gear_multistrike_rating=1600
# gear_versatility_rating=270
# gear_avoidance_rating=201
# gear_armor=1761
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1
summon_pet=cat

Oule

Oule : 101141 dps, 101141 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
101140.6 101140.6 41.2 / 0.041% 12910.1 / 12.8% 6884.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.3 13.3 Focus 0.00% 46.0 100.0% 100%
Origin https://eu.api.battle.net/wow/character/arathor/Oule/advanced
Talents
  • 15: Crouching Tiger, Hidden Chimaera
  • 30: Binding Shot
  • 45: Iron Hawk
  • 60: Thrill of the Hunt
  • 75: Stampede
  • 90: Barrage
  • 100: Lone Wolf
  • Talent Calculator
Glyphs
  • Glyph of Chimaera Shot
  • Glyph of Disengage
  • Glyph of Deterrence
  • Glyph of Aspect of the Cheetah
  • Glyph of Aspect of the Pack
  • Glyph of Revive Pet
Professions
  • engineering: 700
  • enchanting: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% M-Count M-Hit M-Crit M-Crit% Up%
Oule 101141
Aimed Shot 27956 27.7% 91.2 4.89sec 137868 137252 Direct 91.2 47219 129475 119773 88.2% 0.0% 0.0% 46.2 14165 38843 88.2%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.24 91.18 0.00 0.00 1.0045 0.0000 12579260.07 19332336.53 34.93 137251.75 137251.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 40.72 88.22% 38842.55 32931 52346 38895.63 34257 44736 1581488 2430498 34.93
multistrike 5.44 11.78% 14165.00 14160 20348 14096.23 0 17254 76987 118317 34.76
hit 10.75 11.79% 47219.07 47200 67826 47217.86 47200 51326 507809 780422 34.93
crit 80.42 88.21% 129474.77 109771 174486 129678.81 121471 141930 10412976 16003100 34.93
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.focusing_shot.enabled
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals $sw2 Physical damage. Castable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
auto_shot 8265 8.2% 169.8 2.66sec 21882 9255 Direct 169.8 10900 25445 18996 55.7% 0.0% 0.0% 86.0 3270 7634 55.7%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 169.82 169.82 0.00 0.00 2.3643 0.0000 3716110.26 5711074.72 34.93 9255.24 9255.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 47.88 55.70% 7633.68 6933 11040 7636.92 6954 8489 365526 561755 34.93
multistrike 38.09 44.30% 3270.36 2981 4747 3271.81 2981 3859 124567 191441 34.93
hit 75.30 44.34% 10900.30 9938 15823 10904.27 10203 11783 820767 1261389 34.93
crit 94.53 55.66% 25445.30 23111 36799 25457.14 24078 26926 2405250 3696490 34.93
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 7450 7.4% 15.9 24.51sec 209767 72022 Periodic 252.2 6196 14410 10746 55.4% 0.0% 0.0% 128.1 2857 6644 55.4% 9.4%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.95 15.95 254.41 252.21 2.9125 0.1668 3345080.12 4799974.73 30.31 72022.39 72022.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 71.0 55.43% 6643.86 6618 9510 6643.49 6618 7379 471818 471818 0.00
multistrike 57.1 44.57% 2856.96 2846 4089 2856.74 2846 3189 163164 163164 0.00
hit 112.5 44.61% 6196.18 6172 8870 6195.79 6172 6823 697167 1071435 34.93
crit 139.7 55.39% 14409.95 14355 20627 14409.01 14355 16268 2012931 3093558 34.93
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
Chimaera Shot 0 (20786) 0.0% (20.6%) 45.1 10.09sec 207147 206220

Stats details: chimaera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.13 45.13 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 206219.75 206219.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.02 44.37% 0.00 0 0 0.00 0 0 0 0 0.00
crit 25.11 55.63% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: chimaera_shot

Static Values
  • id:53209
  • school:froststrike
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53209
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:A two-headed shot that hits your primary target and another nearby target, dealing $171454sw3 Nature or Frost damage to each target.
 
    Chimaera Shot (_frost) 10338 10.2% 0.0 0.00sec 0 0 Direct 22.5 103299 240350 179534 55.6% 0.0% 0.0% 11.3 30982 72140 55.8%  

Stats details: chimaera_shot_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 22.49 0.00 0.00 0.0000 0.0000 4650838.15 4650838.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.33 55.81% 72140.46 66805 106190 72002.07 0 106190 456960 456960 0.00
multistrike 5.02 44.19% 30981.80 28726 45661 30753.96 0 45661 155379 155379 0.00
hit 9.98 44.37% 103298.98 95752 152203 103352.83 0 152203 1031098 1031098 0.00
crit 12.51 55.63% 240349.93 222684 353968 240473.32 222684 319993 3007401 3007401 0.00
 
 

Action details: chimaera_shot_frost

Static Values
  • id:171454
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171454
  • name:Chimaera Shot
  • school:frost
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171454sw3 Nature or Frost damage to each target.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.60
 
    Chimaera Shot (_nature) 10447 10.3% 0.0 0.00sec 0 0 Direct 22.5 104058 242225 180874 55.6% 0.0% 0.0% 11.4 31214 72670 55.6%  

Stats details: chimaera_shot_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 22.54 0.00 0.00 0.0000 0.0000 4697721.64 4697721.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.36 55.63% 72670.46 67311 106995 72478.84 0 106995 462247 462247 0.00
multistrike 5.07 44.37% 31213.92 28943 46007 30977.16 0 46007 158339 158339 0.00
hit 10.01 44.40% 104058.18 96478 153356 104072.87 0 141581 1041504 1041504 0.00
crit 12.53 55.60% 242225.24 224371 356649 242321.85 224371 309654 3035631 3035631 0.00
 
 

Action details: chimaera_shot_nature

Static Values
  • id:171457
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171457
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171454sw3 Nature or Frost damage to each target.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.65
 
Kill Shot 9466 9.4% 27.1 5.74sec 156982 156279 Direct 27.0 78765 183270 136750 55.5% 0.0% 0.0% 13.7 23626 54970 55.6%  

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.08 26.99 0.00 0.00 1.0045 0.0000 4251109.98 6533284.81 34.93 156279.32 156279.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.60 55.63% 54970.46 51708 74303 54963.18 0 74303 417603 641790 34.91
multistrike 6.06 44.37% 23626.22 22234 31950 23596.25 0 31950 143149 219998 34.87
hit 12.01 44.51% 78765.04 74113 106499 78781.90 74113 98402 946201 1454162 34.93
crit 14.97 55.49% 183269.57 172359 247676 183303.92 172359 214202 2744156 4217335 34.93
 
 

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:80.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing $sw2 Physical damage. Only usable on enemies with less than 20% health. If the target dies, the Hunter will regain {$164851s1=15}% of maximum health. If Kill Shot fails to kill the target, the cooldown is reset.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.85
 
Maalus 11378 11.2% 4.1 120.84sec 1236911 0 Direct 4.1 1236922 0 1236922 0.0% 0.0% 0.0% 0.0 0 0 0.0%  

Stats details: maalus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.13 4.13 0.00 0.00 0.0000 0.0000 5107806.96 5107806.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.13 100.00% 1236921.51 554040 2156587 1239096.51 960315 1537998 5107807 5107807 0.00
 
 

Action details: maalus

Static Values
  • id:187626
  • school:arcane
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187626
  • name:Maalus
  • school:arcane
  • tooltip:
  • description:{$@spelldesc187615=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2624965.38
  • base_dd_max:2624965.38
 
Stampede 0 (5128) 0.0% (5.0%) 2.0 361.82sec 1144989 1140428

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 1140427.66 1140427.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.rapid_fire.up|buff.bloodlust.up|target.time_to_die<=25
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:
  • description:Summons all of your pets to fight your current target for {$d=40 seconds}. While in an Arena or Battleground, these pets deal only ${100+$130201m1}% of their normal damage.
 
    melee (raptor) 6135 1.0% 64.4 6.25sec 7117 5947 Direct 64.4 3666 7445 6179 66.5% 0.0% 0.0% 32.6 1101 2234 66.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.36 64.36 0.00 0.00 1.1968 0.0000 458109.40 704041.81 34.93 5947.00 5947.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.66 66.45% 2233.60 1777 2921 2237.00 1793 2740 48372 74341 34.93
multistrike 10.94 33.55% 1100.62 888 1461 1102.18 888 1461 12037 18499 34.93
hit 21.56 33.50% 3666.43 2962 4868 3671.25 3068 4588 79062 121506 34.93
crit 42.80 66.50% 7444.59 5923 9737 7455.65 6721 8345 318638 489696 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (wolf) 6134 1.0% 64.4 6.25sec 7117 5947 Direct 64.4 3667 7444 6179 66.5% 0.0% 0.0% 32.6 1100 2233 66.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.36 64.36 0.00 0.00 1.1968 0.0000 458100.33 704027.88 34.93 5946.88 5946.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.66 66.47% 2232.78 1777 2921 2235.89 1816 2733 48366 74331 34.93
multistrike 10.93 33.53% 1100.33 888 1461 1101.74 888 1461 12022 18476 34.93
hit 21.56 33.49% 3666.86 2962 4868 3672.12 3009 4505 79050 121487 34.93
crit 42.81 66.51% 7444.14 5923 9737 7455.12 6745 8429 318662 489733 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (hyena) 6135 1.0% 64.4 6.25sec 7117 5947 Direct 64.4 3666 7445 6179 66.5% 0.0% 0.0% 32.6 1100 2234 66.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.36 64.36 0.00 0.00 1.1968 0.0000 458116.50 704052.73 34.93 5947.09 5947.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.66 66.46% 2233.60 1777 2921 2236.73 1814 2811 48372 74340 34.93
multistrike 10.93 33.54% 1100.26 888 1461 1101.78 0 1461 12025 18480 34.93
hit 21.56 33.50% 3665.63 2962 4868 3670.16 3004 4537 79042 121476 34.93
crit 42.80 66.50% 7445.39 5923 9737 7456.35 6682 8479 318677 489757 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (devilsaur) 6130 1.0% 64.4 6.25sec 7112 5942 Direct 64.4 3667 7444 6173 66.3% 0.0% 0.0% 32.6 1100 2232 66.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.36 64.36 0.00 0.00 1.1968 0.0000 457755.89 703498.53 34.93 5942.41 5942.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.67 66.42% 2232.34 1777 2921 2235.79 1845 2734 48382 74355 34.93
multistrike 10.96 33.58% 1099.86 888 1461 1101.38 888 1461 12052 18522 34.93
hit 21.66 33.66% 3666.98 2962 4868 3671.88 2990 4732 79440 122087 34.93
crit 42.70 66.34% 7444.29 5923 9737 7455.35 6643 8429 317881 488534 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    melee (cat) 6132 1.0% 64.4 6.25sec 7114 5944 Direct 64.4 3668 7443 6177 66.5% 0.0% 0.0% 32.6 1100 2233 66.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.36 64.36 0.00 0.00 1.1968 0.0000 457896.62 703714.81 34.93 5944.24 5944.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.62 66.37% 2232.90 1777 2921 2236.09 1858 2764 48280 74198 34.93
multistrike 10.96 33.63% 1100.19 888 1461 1101.77 0 1461 12055 18526 34.93
hit 21.59 33.54% 3668.36 2962 4868 3673.23 3027 4466 79200 121718 34.93
crit 42.77 66.46% 7442.71 5923 9737 7453.75 6676 8506 318362 489272 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Steady Shot 6027 6.0% 144.4 3.06sec 18788 11437 Direct 144.2 8078 20073 16341 68.9% 0.0% 0.0% 73.0 2423 6022 68.9%  

Stats details: steady_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.44 144.17 0.00 0.00 1.6428 0.0000 2713689.78 4170512.71 34.93 11436.66 11436.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 50.29 68.88% 6021.95 5598 8899 6024.23 5598 6741 302830 465402 34.93
multistrike 22.72 31.12% 2423.25 2407 3459 2423.09 2407 2670 55052 84606 34.93
hit 44.86 31.11% 8078.16 8024 11530 8077.77 8024 8474 362353 556880 34.93
crit 99.31 68.89% 20072.97 18661 29663 20082.08 19267 20980 1993455 3063625 34.93
 
 

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.deficit*cast_time%(14+cast_regen)>cooldown.rapid_fire.remains
Spelldata
  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes $sw2 Physical damage and generates {$77443s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
pet - mirror_image_(trinket) 13610 / 4685
Felstorm 13610 4.6% 62.3 30.53sec 33800 3512 Periodic 379.5 2916 5857 4490 55.0% 1.5% 3.6% 189.2 1360 2730 55.8% 133.3%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.31 62.31 379.54 379.54 9.6244 1.5802 2106162.12 3050227.45 30.95 3511.88 3511.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 101.7 55.86% 2730.47 2295 3611 2731.52 2504 3015 277816 277816 0.00
multistrike_crit (blocked) 3.9 1.03% 2728.46 2295 3611 2666.71 0 3611 10621 10621 0.00
multistrike 80.4 44.14% 1359.56 1147 1806 1359.89 1239 1504 109327 109327 0.00
multistrike (blocked) 3.1 0.82% 1359.99 1147 1806 1293.55 0 1806 4214 4214 0.00
hit 159.0 41.88% 2948.75 2489 3916 2949.65 2768 3170 468705 720325 34.93
hit (blocked) 6.1 1.61% 2062.68 1742 2741 2057.04 0 2741 12581 27622 54.28
crit 201.1 52.99% 5922.50 4977 7833 5924.63 5537 6276 1191165 1830633 34.93
crit (blocked) 7.7 2.02% 4147.25 3484 5483 4144.43 0 5483 31733 69670 54.41
parry 5.7 1.50% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: felstorm

Static Values
  • id:184279
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184279
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $184280m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:Strikes all nearby targets within $184280A1 yards for $184280m1% weapon damage every $t1 sec for {$d=20 seconds}. The Mirror Image cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: felstorm_tick

Static Values
  • id:184280
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184280
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc184279=Strikes all nearby targets within $184280A1 yards for $184280m1% weapon damage every $t1 sec for {$d=20 seconds}. The Mirror Image cannot perform any other abilities during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.50
 
pet - raptor 6135 / 1026
melee 6135 1.0% 64.4 6.25sec 7117 5947 Direct 64.4 3666 7445 6179 66.5% 0.0% 0.0% 32.6 1101 2234 66.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.36 64.36 0.00 0.00 1.1968 0.0000 458109.40 704041.81 34.93 5947.00 5947.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.66 66.45% 2233.60 1777 2921 2237.00 1793 2740 48372 74341 34.93
multistrike 10.94 33.55% 1100.62 888 1461 1102.18 888 1461 12037 18499 34.93
hit 21.56 33.50% 3666.43 2962 4868 3671.25 3068 4588 79062 121506 34.93
crit 42.80 66.50% 7444.59 5923 9737 7455.65 6721 8345 318638 489696 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - wolf 6134 / 1026
melee 6134 1.0% 64.4 6.25sec 7117 5947 Direct 64.4 3667 7444 6179 66.5% 0.0% 0.0% 32.6 1100 2233 66.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.36 64.36 0.00 0.00 1.1968 0.0000 458100.33 704027.88 34.93 5946.88 5946.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.66 66.47% 2232.78 1777 2921 2235.89 1816 2733 48366 74331 34.93
multistrike 10.93 33.53% 1100.33 888 1461 1101.74 888 1461 12022 18476 34.93
hit 21.56 33.49% 3666.86 2962 4868 3672.12 3009 4505 79050 121487 34.93
crit 42.81 66.51% 7444.14 5923 9737 7455.12 6745 8429 318662 489733 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - hyena 6135 / 1026
melee 6135 1.0% 64.4 6.25sec 7117 5947 Direct 64.4 3666 7445 6179 66.5% 0.0% 0.0% 32.6 1100 2234 66.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.36 64.36 0.00 0.00 1.1968 0.0000 458116.50 704052.73 34.93 5947.09 5947.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.66 66.46% 2233.60 1777 2921 2236.73 1814 2811 48372 74340 34.93
multistrike 10.93 33.54% 1100.26 888 1461 1101.78 0 1461 12025 18480 34.93
hit 21.56 33.50% 3665.63 2962 4868 3670.16 3004 4537 79042 121476 34.93
crit 42.80 66.50% 7445.39 5923 9737 7456.35 6682 8479 318677 489757 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - devilsaur 6130 / 1025
melee 6130 1.0% 64.4 6.25sec 7112 5942 Direct 64.4 3667 7444 6173 66.3% 0.0% 0.0% 32.6 1100 2232 66.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.36 64.36 0.00 0.00 1.1968 0.0000 457755.89 703498.53 34.93 5942.41 5942.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.67 66.42% 2232.34 1777 2921 2235.79 1845 2734 48382 74355 34.93
multistrike 10.96 33.58% 1099.86 888 1461 1101.38 888 1461 12052 18522 34.93
hit 21.66 33.66% 3666.98 2962 4868 3671.88 2990 4732 79440 122087 34.93
crit 42.70 66.34% 7444.29 5923 9737 7455.35 6643 8429 317881 488534 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - cat 6132 / 1025
melee 6132 1.0% 64.4 6.25sec 7114 5944 Direct 64.4 3668 7443 6177 66.5% 0.0% 0.0% 32.6 1100 2233 66.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.36 64.36 0.00 0.00 1.1968 0.0000 457896.62 703714.81 34.93 5944.24 5944.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.62 66.37% 2232.90 1777 2921 2236.09 1858 2764 48280 74198 34.93
multistrike 10.96 33.63% 1100.19 888 1461 1101.77 0 1461 12055 18526 34.93
hit 21.59 33.54% 3668.36 2962 4868 3673.23 3027 4466 79200 121718 34.93
crit 42.77 66.46% 7442.71 5923 9737 7453.75 6676 8506 318362 489272 34.93
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Oule
Burning Mirror 7.9 60.77sec

Stats details: burning_mirror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 7.95 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: burning_mirror

Static Values
  • id:184270
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:184270
  • name:Burning Mirror
  • school:arcane
  • tooltip:
  • description:Summons {$?s19574=false}[${$m1/2}][$m1] Mirror Images to attack your target and nearby enemies for {$184271d=20 seconds}.
 
Draenic Agility Potion (potion) 1.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 1.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: potion

Static Values
  • id:156423
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your Agility by {$s1=1000} for {$d=25 seconds}.
 
nitro_boosts 1.0 0.00sec

Stats details: nitro_boosts

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 1.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: nitro_boosts

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Rapid Fire 4.3 121.22sec

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases haste by $w1%.
  • description:Increases haste by {$s1=40}% for {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.03% 14.03% 0.0(0.0)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Careful Aim 11.3 0.0 41.4sec 35.5sec 31.85% 46.69% 0.0(0.0)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_careful_aim
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • careful_aim_1:31.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:34483
  • name:Careful Aim
  • tooltip:
  • description:Increases the critical strike chance of your Steady Shot, Focusing Shot, and Aimed Shot by {$s1=50}% on targets who are above {$s2=80}% health or while Rapid Fire is active.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Draenic Agility Potion 1.0 0.0 0.0sec 0.0sec 5.19% 5.21% 0.0(0.0)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:5.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your Agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Maalus 4.3 0.0 120.8sec 120.8sec 14.21% 21.40% 0.0(0.0)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_maalus
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • maalus_1:14.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187620
  • name:Maalus
  • tooltip:$?$w1>0[Damage dealt increased by $w1%. When this effect ends, the triggering ally will explode for $w1% of all damage dealt while empowered.][Contributing toward the master's Savage Hollows.]
  • description:{$@spelldesc187615=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Megawatt Filament 10.4 3.5 44.6sec 32.7sec 32.18% 32.19% 3.5(3.5)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_megawatt_filament
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:750.00

Stack Uptimes

  • megawatt_filament_1:32.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156060
  • name:Megawatt Filament
  • tooltip:Critical strike increased by $w1.
  • description:Critical strike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Nitro Boosts 1.0 0.0 0.0sec 0.0sec 1.13% 1.14% 0.0(0.0)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_nitro_boosts
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nitro_boosts_1:1.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:54861
  • name:Nitro Boosts
  • tooltip:Speed increased by {$s1=150}%.
  • description:Increase your speed by {$s1=150}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Rapid Fire 4.3 0.0 121.2sec 121.2sec 13.71% 17.11% 0.0(0.0)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rapid_fire_1:13.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases haste by $w1%.
  • description:Increases haste by {$s1=40}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Rapid Fire (_t18) 9.1 0.0 44.6sec 44.6sec 7.61% 23.81% 0.0(0.0)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_rapid_fire_t18
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:0.40

Stack Uptimes

  • rapid_fire_t18_1:7.61%

Trigger Attempt Success

  • trigger_pct:40.09%

Spelldata details

  • id:188202
  • name:Rapid Fire
  • tooltip:Increases haste by $w1%.
  • description:Increases haste by {$s1=40}% for {$d=4 seconds}.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Mastery: Sniper Training (sniper_training) 1.0 899.5 0.0sec 0.5sec 100.00% 100.00% 899.5(899.5)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_sniper_training
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sniper_training_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:76659
  • name:Mastery: Sniper Training
  • tooltip:
  • description:When you stand still for {$168809d=3 seconds}, you gain Sniper Training for {$s3=6} sec, which increases your damage, shot range, and critical strike damage by {$s1=0}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.8sec 361.8sec 16.74% 16.76% 0.0(0.0)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:16.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill of the Hunt 19.0 16.8 23.7sec 12.5sec 50.74% 73.26% 16.8(32.7)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_thrill_of_the_hunt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • thrill_of_the_hunt_1:12.27%
  • thrill_of_the_hunt_2:17.90%
  • thrill_of_the_hunt_3:20.57%

Trigger Attempt Success

  • trigger_pct:23.45%

Spelldata details

  • id:34720
  • name:Thrill of the Hunt
  • tooltip:Reduces the Focus cost of your next Arcane Shot, Aimed Shot, or Multi-Shot by {$s1=20}.
  • description:{$@spelldesc109306=You have a {$s1=6}% chance per 10 Focus spent on Focus-costing attacks to trigger Thrill of the Hunt. Thrill of the Hunt reduces the Focus cost of your next {$s2=3} Arcane Shots, Aimed Shots, or Multi-Shots by {$34720s1=20}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Stampede 2.0 0.0 361.8sec 361.8sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Oule_cat
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.8sec 361.8sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Oule_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.8sec 361.8sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Oule_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.8sec 361.8sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Oule_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stampede 2.0 0.0 361.8sec 361.8sec 100.00% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Oule_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:40.03
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Stance of the Fierce Tiger (fierce_tiger_movement_aura)

Buff details

  • buff initial source:Oule
  • cooldown name:buff_fierce_tiger_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fierce_tiger_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:
  • description:Increases all damage dealt by {$s3=10}%. Grants you and your allies within $m7 yards {$166646s1=10}% increased movement speed, and improves the functionality of Jab, Expel Harm, Tiger Palm, Blackout Kick, and Rising Sun Kick.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Draenic Agility Flask

Buff details

  • buff initial source:Oule
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
pickled_eel_food

Buff details

  • buff initial source:Oule
  • cooldown name:buff_pickled_eel_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:125.00

Stack Uptimes

  • pickled_eel_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Oule
aimed_shot Focus 91.2 3428.2 37.6 37.6 3669.3
barrage Focus 15.9 956.8 60.0 60.0 3496.1
chimaera_shot Focus 45.1 1579.6 35.0 35.0 5918.5
Resource Gains Type Count Total Average Overflow
focus_regen Focus 917.05 2254.45 (31.20%) 2.46 0.20 0.01%
thrill_of_the_hunt_savings Focus 67.05 1340.92 (18.56%) 20.00 0.00 0.00%
steady_shot Focus 144.44 2021.32 (27.98%) 13.99 0.81 0.04%
aimed_shot Focus 80.42 1608.49 (22.26%) 20.00 0.00 0.00%
pet - raptor
focus_regen Focus 137.19 0.00 (0.00%) 0.00 566.99 100.00%
pet - wolf
focus_regen Focus 137.19 0.00 (0.00%) 0.00 566.99 100.00%
pet - hyena
focus_regen Focus 137.19 0.00 (0.00%) 0.00 566.99 100.00%
pet - devilsaur
focus_regen Focus 137.19 0.00 (0.00%) 0.00 566.99 100.00%
pet - cat
focus_regen Focus 137.19 0.00 (0.00%) 0.00 566.99 100.00%
Resource RPS-Gain RPS-Loss
Focus 13.08 13.25
Combat End Resource Mean Min Max
Focus 40.07 0.02 117.14

Benefits & Uptimes

Benefits %
aimed_in_careful_aim 73.2%
Uptimes %
Focus Cap 0.0%

Procs

Count Interval
starved: chimaera_shot 10.4 39.9sec
starved: barrage 69.8 6.0sec
thrill_of_the_hunt 35.8 12.4sec
tier18_2pc_mm_wasted_proc 0.7 184.1sec
tier18_2pc_mm_wasted_overwrite 4.3 121.2sec

Statistics & Data Analysis

Fight Length
Sample Data Oule Fight Length
Count 24999
Mean 450.01
Minimum 351.82
Maximum 558.10
Spread ( max - min ) 206.27
Range [ ( max - min ) / 2 * 100% ] 22.92%
DPS
Sample Data Oule Damage Per Second
Count 24999
Mean 101140.56
Minimum 88716.50
Maximum 115284.67
Spread ( max - min ) 26568.17
Range [ ( max - min ) / 2 * 100% ] 13.13%
Standard Deviation 3326.8986
5th Percentile 95868.71
95th Percentile 106811.91
( 95th Percentile - 5th Percentile ) 10943.20
Mean Distribution
Standard Deviation 21.0416
95.00% Confidence Intervall ( 101099.32 - 101181.80 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4156
0.1 Scale Factor Error with Delta=300 94484
0.05 Scale Factor Error with Delta=300 377939
0.01 Scale Factor Error with Delta=300 9448498
Priority Target DPS
Sample Data Oule Priority Target Damage Per Second
Count 24999
Mean 101140.56
Minimum 88716.50
Maximum 115284.67
Spread ( max - min ) 26568.17
Range [ ( max - min ) / 2 * 100% ] 13.13%
Standard Deviation 3326.8986
5th Percentile 95868.71
95th Percentile 106811.91
( 95th Percentile - 5th Percentile ) 10943.20
Mean Distribution
Standard Deviation 21.0416
95.00% Confidence Intervall ( 101099.32 - 101181.80 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4156
0.1 Scale Factor Error with Delta=300 94484
0.05 Scale Factor Error with Delta=300 377939
0.01 Scale Factor Error with Delta=300 9448498
DPS(e)
Sample Data Oule Damage Per Second (Effective)
Count 24999
Mean 101140.56
Minimum 88716.50
Maximum 115284.67
Spread ( max - min ) 26568.17
Range [ ( max - min ) / 2 * 100% ] 13.13%
Damage
Sample Data Oule Damage
Count 24999
Mean 41061616.96
Minimum 29331128.33
Maximum 53617948.66
Spread ( max - min ) 24286820.33
Range [ ( max - min ) / 2 * 100% ] 29.57%
DTPS
Sample Data Oule Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Oule Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Oule Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Oule Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Oule Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Oule Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data OuleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Oule Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=pickled_eel
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=spell_targets.multi_shot<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=spell_targets.multi_shot>=3
6 0.00 potion,name=draenic_agility
7 0.00 glaive_toss
8 0.00 focusing_shot
Default action list Executed every time the actor is available.
# count action,conditions
9 1.00 auto_shot
A 1.00 use_item,name=torchbrazed_waistguard
B 4.34 use_item,name=maalus_the_blood_drinker
C 7.95 use_item,name=mirror_of_the_blademaster
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
0.00 potion,name=draenic_agility,if=((buff.rapid_fire.up|buff.bloodlust.up)&(cooldown.stampede.remains<1))|target.time_to_die<=25
D 45.13 chimaera_shot
E 27.08 kill_shot
F 4.32 rapid_fire
G 2.00 stampede,if=buff.rapid_fire.up|buff.bloodlust.up|target.time_to_die<=25
H 0.00 call_action_list,name=careful_aim,if=buff.careful_aim.up
0.00 explosive_trap,if=spell_targets.explosive_trap_tick>1
0.00 a_murder_of_crows
0.00 dire_beast,if=cast_regen+action.aimed_shot.cast_regen<focus.deficit
0.00 glaive_toss
0.00 powershot,if=cast_regen<focus.deficit
I 15.95 barrage
J 6.97 steady_shot,if=focus.deficit*cast_time%(14+cast_regen)>cooldown.rapid_fire.remains
Pool max focus for rapid fire so we can spam AimedShot with Careful Aim buff
0.00 focusing_shot,if=focus.deficit*cast_time%(50+cast_regen)>cooldown.rapid_fire.remains&focus<100
0.00 steady_shot,if=buff.pre_steady_focus.up&(14+cast_regen+action.aimed_shot.cast_regen)<=focus.deficit
Cast a second shot for steady focus if that won't cap us.
0.00 multishot,if=spell_targets.multi_shot>6
0.00 aimed_shot,if=talent.focusing_shot.enabled
K 8.51 aimed_shot,if=focus+cast_regen>=85
L 15.73 aimed_shot,if=buff.thrill_of_the_hunt.react&focus+cast_regen>=65
0.00 focusing_shot,if=50+cast_regen-10<focus.deficit
Allow FS to over-cap by 10 if we have nothing else to do
M 94.36 steady_shot
actions.careful_aim
# count action,conditions
0.00 glaive_toss,if=active_enemies>2
0.00 powershot,if=spell_targets.powershot>1&cast_regen<focus.deficit
0.00 barrage,if=spell_targets.barrage>1
N 67.00 aimed_shot
0.00 focusing_shot,if=50+cast_regen<focus.deficit
O 43.53 steady_shot

Sample Sequence

0169BCDFGNNNONONODONONONONODOONNNNONODOONNNONNNODOONONODOOANOCNODMNONNMIMDMMMLMDMMLMIMDMMLMLMDMMLMIJBDCFONONNNOODONNNNOMDMIMMDMNNNOMKDMNONNMIMDMONOMLMCDMLMIMDMMLMLLDMMMIDMMMLLMDMMMKIMDJJJBJFNCDNNNNONONDOONOMIMDMMMLLLDMNNOMIMDEEMMLMDMEEKMCIDMMEEMMDLMLMEEIMDMMEELLMDMNNOEEIMDMMEEJBJDCFGNNNNEENDOONONOEDEMIMMDEEMMLMDMEEIMDMMEEMKDMMCMEEIDMMMEEKDMM

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 120.0/120: 100% focus sniper_training
Pre food Fluffy_Pillow 120.0/120: 100% focus sniper_training
Pre potion Fluffy_Pillow 120.0/120: 100% focus sniper_training, draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 120.0/120: 100% focus sniper_training, draenic_agility_potion
0:00.000 use_item_maalus_the_blood_drinker Fluffy_Pillow 120.0/120: 100% focus sniper_training, draenic_agility_potion
0:00.000 use_item_mirror_of_the_blademaster Fluffy_Pillow 120.0/120: 100% focus sniper_training, maalus, draenic_agility_potion
0:00.000 chimaera_shot Fluffy_Pillow 120.0/120: 100% focus sniper_training, maalus, draenic_agility_potion
0:01.003 rapid_fire Fluffy_Pillow 90.7/120: 76% focus bloodlust, sniper_training, rapid_fire_t18, maalus, megawatt_filament, draenic_agility_potion
0:01.003 stampede Fluffy_Pillow 90.7/120: 76% focus bloodlust, rapid_fire, sniper_training, maalus, megawatt_filament, draenic_agility_potion
0:02.008 aimed_shot Fluffy_Pillow 98.9/120: 82% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:03.011 aimed_shot Fluffy_Pillow 77.1/120: 64% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:04.016 aimed_shot Fluffy_Pillow 55.4/120: 46% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:05.021 steady_shot Fluffy_Pillow 33.6/120: 28% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:06.025 aimed_shot Fluffy_Pillow 55.8/120: 46% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:07.029 steady_shot Fluffy_Pillow 34.0/120: 28% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:08.034 aimed_shot Fluffy_Pillow 56.2/120: 47% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:09.036 steady_shot Fluffy_Pillow 34.4/120: 29% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:10.039 chimaera_shot Fluffy_Pillow 56.6/120: 47% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:11.043 steady_shot Fluffy_Pillow 29.8/120: 25% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:12.048 aimed_shot Fluffy_Pillow 52.0/120: 43% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, megawatt_filament, draenic_agility_potion
0:13.052 steady_shot Fluffy_Pillow 30.2/120: 25% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, draenic_agility_potion
0:14.056 aimed_shot Fluffy_Pillow 52.4/120: 44% focus bloodlust, rapid_fire, sniper_training, stampede, maalus, draenic_agility_potion
0:15.060 steady_shot Fluffy_Pillow 30.6/120: 26% focus bloodlust, rapid_fire, sniper_training, stampede, draenic_agility_potion
0:16.063 aimed_shot Fluffy_Pillow 52.7/120: 44% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:17.067 steady_shot Fluffy_Pillow 28.5/120: 24% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:18.442 aimed_shot Fluffy_Pillow 50.6/120: 42% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:19.447 steady_shot Fluffy_Pillow 26.4/120: 22% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:20.823 chimaera_shot Fluffy_Pillow 48.5/120: 40% focus bloodlust, sniper_training, stampede, draenic_agility_potion
0:21.829 steady_shot Fluffy_Pillow 19.4/120: 16% focus bloodlust, sniper_training, stampede, rapid_fire_t18, draenic_agility_potion
0:22.834 steady_shot Fluffy_Pillow 41.6/120: 35% focus bloodlust, sniper_training, stampede, rapid_fire_t18, megawatt_filament, draenic_agility_potion
0:23.838 aimed_shot Fluffy_Pillow 63.8/120: 53% focus bloodlust, sniper_training, stampede, rapid_fire_t18, megawatt_filament
0:24.841 aimed_shot Fluffy_Pillow 42.0/120: 35% focus bloodlust, thrill_of_the_hunt(2), sniper_training, stampede, rapid_fire_t18, megawatt_filament
0:25.845 aimed_shot Fluffy_Pillow 40.1/120: 33% focus bloodlust, thrill_of_the_hunt(2), sniper_training, stampede, megawatt_filament
0:26.850 aimed_shot Fluffy_Pillow 36.0/120: 30% focus bloodlust, thrill_of_the_hunt, sniper_training, stampede, megawatt_filament
0:27.855 steady_shot Fluffy_Pillow 31.9/120: 27% focus bloodlust, sniper_training, stampede, megawatt_filament
0:29.229 aimed_shot Fluffy_Pillow 53.9/120: 45% focus bloodlust, sniper_training, stampede, megawatt_filament
0:30.234 steady_shot Fluffy_Pillow 29.8/120: 25% focus bloodlust, sniper_training, stampede, megawatt_filament
0:31.609 chimaera_shot Fluffy_Pillow 51.8/120: 43% focus bloodlust, sniper_training, stampede, megawatt_filament
0:32.612 steady_shot Fluffy_Pillow 22.6/120: 19% focus bloodlust, sniper_training, stampede, rapid_fire_t18, megawatt_filament
0:33.616 steady_shot Fluffy_Pillow 44.8/120: 37% focus bloodlust, sniper_training, stampede, rapid_fire_t18, megawatt_filament
0:34.622 aimed_shot Fluffy_Pillow 67.1/120: 56% focus bloodlust, sniper_training, stampede, rapid_fire_t18, megawatt_filament
0:35.626 aimed_shot Fluffy_Pillow 45.3/120: 38% focus bloodlust, thrill_of_the_hunt(2), sniper_training, stampede, rapid_fire_t18
0:36.630 aimed_shot Fluffy_Pillow 43.4/120: 36% focus bloodlust, thrill_of_the_hunt, sniper_training, stampede
0:37.634 steady_shot Fluffy_Pillow 39.3/120: 33% focus bloodlust, sniper_training, stampede
0:39.008 aimed_shot Fluffy_Pillow 61.3/120: 51% focus bloodlust, sniper_training, stampede
0:40.013 aimed_shot Fluffy_Pillow 37.2/120: 31% focus bloodlust, thrill_of_the_hunt(2), sniper_training, stampede
0:41.018 aimed_shot Fluffy_Pillow 31.7/120: 26% focus thrill_of_the_hunt, sniper_training, stampede
0:42.021 steady_shot Fluffy_Pillow 26.2/120: 22% focus sniper_training
0:43.806 chimaera_shot Fluffy_Pillow 48.2/120: 40% focus sniper_training
0:44.810 steady_shot Fluffy_Pillow 17.7/120: 15% focus sniper_training
0:46.596 steady_shot Fluffy_Pillow 39.7/120: 33% focus sniper_training
0:48.381 aimed_shot Fluffy_Pillow 61.8/120: 51% focus sniper_training
0:49.386 steady_shot Fluffy_Pillow 36.3/120: 30% focus sniper_training
0:51.171 aimed_shot Fluffy_Pillow 58.3/120: 49% focus sniper_training
0:52.176 steady_shot Fluffy_Pillow 32.8/120: 27% focus sniper_training
0:53.961 chimaera_shot Fluffy_Pillow 54.8/120: 46% focus sniper_training
0:54.965 steady_shot Fluffy_Pillow 24.3/120: 20% focus sniper_training
0:56.751 steady_shot Fluffy_Pillow 46.4/120: 39% focus sniper_training
0:58.537 use_item_torchbrazed_waistguard Fluffy_Pillow 68.4/120: 57% focus sniper_training
0:58.537 aimed_shot Fluffy_Pillow 68.4/120: 57% focus nitro_boosts, sniper_training
0:59.543 steady_shot Fluffy_Pillow 42.9/120: 36% focus nitro_boosts, sniper_training
1:01.329 use_item_mirror_of_the_blademaster Fluffy_Pillow 64.9/120: 54% focus nitro_boosts, sniper_training
1:01.329 aimed_shot Fluffy_Pillow 64.9/120: 54% focus nitro_boosts, sniper_training
1:02.333 steady_shot Fluffy_Pillow 39.4/120: 33% focus nitro_boosts, sniper_training
1:04.118 chimaera_shot Fluffy_Pillow 61.4/120: 51% focus sniper_training
1:05.123 steady_shot Fluffy_Pillow 31.0/120: 26% focus sniper_training, rapid_fire_t18
1:06.400 aimed_shot Fluffy_Pillow 53.0/120: 44% focus careful_aim, sniper_training, rapid_fire_t18
1:07.405 steady_shot Fluffy_Pillow 29.3/120: 24% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18
1:08.681 aimed_shot Fluffy_Pillow 51.3/120: 43% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18
1:09.684 aimed_shot Fluffy_Pillow 46.6/120: 39% focus careful_aim, thrill_of_the_hunt, sniper_training
1:10.687 steady_shot Fluffy_Pillow 41.1/120: 34% focus sniper_training
1:12.471 barrage Fluffy_Pillow 63.1/120: 53% focus sniper_training
1:15.455 steady_shot Fluffy_Pillow 16.5/120: 14% focus sniper_training
1:17.242 chimaera_shot Fluffy_Pillow 38.6/120: 32% focus sniper_training
1:18.246 steady_shot Fluffy_Pillow 8.1/120: 7% focus thrill_of_the_hunt(3), sniper_training
1:20.031 steady_shot Fluffy_Pillow 30.1/120: 25% focus thrill_of_the_hunt(3), sniper_training
1:21.817 steady_shot Fluffy_Pillow 52.1/120: 43% focus thrill_of_the_hunt(3), sniper_training
1:23.602 aimed_shot Fluffy_Pillow 74.1/120: 62% focus thrill_of_the_hunt(3), sniper_training
1:24.605 steady_shot Fluffy_Pillow 48.6/120: 41% focus thrill_of_the_hunt(2), sniper_training
1:26.392 chimaera_shot Fluffy_Pillow 70.7/120: 59% focus thrill_of_the_hunt(2), sniper_training
1:27.397 steady_shot Fluffy_Pillow 40.2/120: 33% focus thrill_of_the_hunt(3), sniper_training
1:29.182 steady_shot Fluffy_Pillow 62.2/120: 52% focus thrill_of_the_hunt(3), sniper_training
1:30.968 aimed_shot Fluffy_Pillow 84.2/120: 70% focus thrill_of_the_hunt(3), sniper_training
1:31.973 steady_shot Fluffy_Pillow 58.7/120: 49% focus thrill_of_the_hunt(2), sniper_training
1:33.760 barrage Fluffy_Pillow 80.7/120: 67% focus thrill_of_the_hunt(3), sniper_training
1:36.815 steady_shot Fluffy_Pillow 34.5/120: 29% focus thrill_of_the_hunt(3), sniper_training
1:38.601 chimaera_shot Fluffy_Pillow 56.5/120: 47% focus thrill_of_the_hunt(3), sniper_training
1:39.605 steady_shot Fluffy_Pillow 26.0/120: 22% focus thrill_of_the_hunt(3), sniper_training
1:41.389 steady_shot Fluffy_Pillow 48.0/120: 40% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
1:43.173 aimed_shot Fluffy_Pillow 70.0/120: 58% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
1:44.178 steady_shot Fluffy_Pillow 44.5/120: 37% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
1:45.963 aimed_shot Fluffy_Pillow 66.5/120: 55% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
1:46.967 steady_shot Fluffy_Pillow 41.1/120: 34% focus thrill_of_the_hunt, sniper_training, megawatt_filament
1:48.752 chimaera_shot Fluffy_Pillow 63.1/120: 53% focus thrill_of_the_hunt, sniper_training, megawatt_filament
1:49.758 steady_shot Fluffy_Pillow 32.6/120: 27% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
1:51.544 steady_shot Fluffy_Pillow 54.6/120: 46% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
1:53.330 aimed_shot Fluffy_Pillow 76.6/120: 64% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
1:54.334 steady_shot Fluffy_Pillow 51.1/120: 43% focus thrill_of_the_hunt(2), sniper_training
1:56.121 barrage Fluffy_Pillow 73.2/120: 61% focus thrill_of_the_hunt(2), sniper_training
1:59.005 steady_shot Fluffy_Pillow 26.1/120: 22% focus thrill_of_the_hunt(2), sniper_training
2:00.790 use_item_maalus_the_blood_drinker Fluffy_Pillow 48.1/120: 40% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
2:00.790 chimaera_shot Fluffy_Pillow 48.1/120: 40% focus thrill_of_the_hunt(2), sniper_training, maalus, megawatt_filament
2:01.795 use_item_mirror_of_the_blademaster Fluffy_Pillow 17.6/120: 15% focus thrill_of_the_hunt(2), sniper_training, maalus, megawatt_filament
2:01.795 rapid_fire Fluffy_Pillow 17.6/120: 15% focus thrill_of_the_hunt(2), sniper_training, maalus, megawatt_filament
2:01.795 steady_shot Fluffy_Pillow 17.6/120: 15% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
2:03.071 aimed_shot Fluffy_Pillow 39.7/120: 33% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
2:04.074 steady_shot Fluffy_Pillow 36.0/120: 30% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:05.350 aimed_shot Fluffy_Pillow 58.0/120: 48% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:06.352 aimed_shot Fluffy_Pillow 34.3/120: 29% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
2:07.358 aimed_shot Fluffy_Pillow 30.6/120: 26% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, maalus, megawatt_filament
2:08.362 steady_shot Fluffy_Pillow 26.9/120: 22% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:09.637 steady_shot Fluffy_Pillow 48.9/120: 41% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:10.914 chimaera_shot Fluffy_Pillow 71.0/120: 59% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:11.918 steady_shot Fluffy_Pillow 42.3/120: 35% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
2:13.192 aimed_shot Fluffy_Pillow 64.3/120: 54% focus careful_aim, rapid_fire, sniper_training, maalus
2:14.197 aimed_shot Fluffy_Pillow 40.6/120: 34% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus
2:15.202 aimed_shot Fluffy_Pillow 36.9/120: 31% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus
2:16.207 aimed_shot Fluffy_Pillow 33.3/120: 28% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training
2:17.212 steady_shot Fluffy_Pillow 28.8/120: 24% focus careful_aim, sniper_training
2:18.999 steady_shot Fluffy_Pillow 50.8/120: 42% focus sniper_training
2:20.784 chimaera_shot Fluffy_Pillow 72.9/120: 61% focus sniper_training
2:21.788 steady_shot Fluffy_Pillow 42.4/120: 35% focus sniper_training
2:23.573 barrage Fluffy_Pillow 64.4/120: 54% focus thrill_of_the_hunt(3), sniper_training
2:26.576 steady_shot Fluffy_Pillow 17.9/120: 15% focus thrill_of_the_hunt(3), sniper_training
2:28.362 steady_shot Fluffy_Pillow 39.9/120: 33% focus thrill_of_the_hunt(3), sniper_training
2:30.147 chimaera_shot Fluffy_Pillow 61.9/120: 52% focus thrill_of_the_hunt(3), sniper_training
2:31.151 steady_shot Fluffy_Pillow 31.4/120: 26% focus thrill_of_the_hunt(3), sniper_training, rapid_fire_t18
2:32.428 aimed_shot Fluffy_Pillow 53.5/120: 45% focus careful_aim, thrill_of_the_hunt(3), sniper_training, rapid_fire_t18
2:33.431 aimed_shot Fluffy_Pillow 49.8/120: 41% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18
2:34.435 aimed_shot Fluffy_Pillow 46.1/120: 38% focus careful_aim, thrill_of_the_hunt, sniper_training, rapid_fire_t18
2:35.439 steady_shot Fluffy_Pillow 41.9/120: 35% focus careful_aim, sniper_training, megawatt_filament
2:37.226 steady_shot Fluffy_Pillow 63.9/120: 53% focus sniper_training, megawatt_filament
2:39.012 aimed_shot Fluffy_Pillow 85.9/120: 72% focus sniper_training, megawatt_filament
2:40.016 chimaera_shot Fluffy_Pillow 40.4/120: 34% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
2:41.020 steady_shot Fluffy_Pillow 9.9/120: 8% focus thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, megawatt_filament
2:42.298 aimed_shot Fluffy_Pillow 32.0/120: 27% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, megawatt_filament
2:43.302 steady_shot Fluffy_Pillow 28.3/120: 24% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, megawatt_filament
2:44.578 aimed_shot Fluffy_Pillow 50.3/120: 42% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18, megawatt_filament
2:45.582 aimed_shot Fluffy_Pillow 45.6/120: 38% focus careful_aim, thrill_of_the_hunt, sniper_training, megawatt_filament
2:46.587 steady_shot Fluffy_Pillow 40.1/120: 33% focus sniper_training
2:48.373 barrage Fluffy_Pillow 62.1/120: 52% focus sniper_training
2:51.241 steady_shot Fluffy_Pillow 15.0/120: 13% focus sniper_training
2:53.026 chimaera_shot Fluffy_Pillow 37.0/120: 31% focus sniper_training
2:54.030 steady_shot Fluffy_Pillow 6.5/120: 5% focus sniper_training, rapid_fire_t18
2:55.309 steady_shot Fluffy_Pillow 28.6/120: 24% focus careful_aim, sniper_training, rapid_fire_t18
2:56.586 aimed_shot Fluffy_Pillow 50.6/120: 42% focus careful_aim, sniper_training, rapid_fire_t18
2:57.591 steady_shot Fluffy_Pillow 26.9/120: 22% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18
2:58.868 steady_shot Fluffy_Pillow 47.4/120: 40% focus thrill_of_the_hunt(2), sniper_training
3:00.653 aimed_shot Fluffy_Pillow 69.5/120: 58% focus thrill_of_the_hunt(2), sniper_training
3:01.655 steady_shot Fluffy_Pillow 64.0/120: 53% focus thrill_of_the_hunt, sniper_training
3:03.441 use_item_mirror_of_the_blademaster Fluffy_Pillow 86.0/120: 72% focus thrill_of_the_hunt, sniper_training
3:03.441 chimaera_shot Fluffy_Pillow 86.0/120: 72% focus thrill_of_the_hunt, sniper_training
3:04.446 steady_shot Fluffy_Pillow 55.5/120: 46% focus thrill_of_the_hunt, sniper_training
3:06.233 aimed_shot Fluffy_Pillow 77.5/120: 65% focus thrill_of_the_hunt, sniper_training
3:07.237 steady_shot Fluffy_Pillow 72.0/120: 60% focus sniper_training
3:09.023 barrage Fluffy_Pillow 94.1/120: 78% focus thrill_of_the_hunt(3), sniper_training
3:12.038 steady_shot Fluffy_Pillow 47.6/120: 40% focus thrill_of_the_hunt(3), sniper_training
3:13.823 chimaera_shot Fluffy_Pillow 69.6/120: 58% focus thrill_of_the_hunt(3), sniper_training
3:14.826 steady_shot Fluffy_Pillow 39.1/120: 33% focus thrill_of_the_hunt(3), sniper_training
3:16.610 steady_shot Fluffy_Pillow 61.1/120: 51% focus thrill_of_the_hunt(3), sniper_training
3:18.396 aimed_shot Fluffy_Pillow 83.1/120: 69% focus thrill_of_the_hunt(3), sniper_training
3:19.399 steady_shot Fluffy_Pillow 57.7/120: 48% focus thrill_of_the_hunt(2), sniper_training
3:21.183 aimed_shot Fluffy_Pillow 79.7/120: 66% focus thrill_of_the_hunt(2), sniper_training
3:22.187 aimed_shot Fluffy_Pillow 74.2/120: 62% focus thrill_of_the_hunt, sniper_training
3:23.191 chimaera_shot Fluffy_Pillow 48.7/120: 41% focus sniper_training
3:24.195 steady_shot Fluffy_Pillow 18.2/120: 15% focus thrill_of_the_hunt(3), sniper_training
3:25.981 steady_shot Fluffy_Pillow 40.2/120: 34% focus thrill_of_the_hunt(3), sniper_training
3:27.766 steady_shot Fluffy_Pillow 62.2/120: 52% focus thrill_of_the_hunt(3), sniper_training
3:29.553 barrage Fluffy_Pillow 84.3/120: 70% focus thrill_of_the_hunt(3), sniper_training
3:32.463 chimaera_shot Fluffy_Pillow 37.3/120: 31% focus thrill_of_the_hunt(3), sniper_training
3:33.467 steady_shot Fluffy_Pillow 6.8/120: 6% focus thrill_of_the_hunt(3), sniper_training
3:35.252 steady_shot Fluffy_Pillow 28.8/120: 24% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
3:37.038 steady_shot Fluffy_Pillow 50.9/120: 42% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
3:38.823 aimed_shot Fluffy_Pillow 72.9/120: 61% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
3:39.827 aimed_shot Fluffy_Pillow 67.4/120: 56% focus thrill_of_the_hunt(2), sniper_training, megawatt_filament
3:40.831 steady_shot Fluffy_Pillow 41.9/120: 35% focus thrill_of_the_hunt, sniper_training, megawatt_filament
3:42.617 chimaera_shot Fluffy_Pillow 63.9/120: 53% focus thrill_of_the_hunt, sniper_training, megawatt_filament
3:43.621 steady_shot Fluffy_Pillow 33.4/120: 28% focus thrill_of_the_hunt, sniper_training, megawatt_filament
3:45.406 steady_shot Fluffy_Pillow 55.4/120: 46% focus sniper_training, megawatt_filament
3:47.191 steady_shot Fluffy_Pillow 77.5/120: 65% focus sniper_training
3:48.975 aimed_shot Fluffy_Pillow 99.5/120: 83% focus sniper_training
3:49.982 barrage Fluffy_Pillow 74.0/120: 62% focus sniper_training
3:52.923 steady_shot Fluffy_Pillow 27.2/120: 23% focus sniper_training
3:54.708 chimaera_shot Fluffy_Pillow 49.2/120: 41% focus sniper_training
3:55.712 steady_shot Fluffy_Pillow 18.7/120: 16% focus sniper_training
3:57.496 steady_shot Fluffy_Pillow 40.7/120: 34% focus sniper_training
3:59.280 steady_shot Fluffy_Pillow 62.8/120: 52% focus sniper_training, megawatt_filament
4:01.066 use_item_maalus_the_blood_drinker Fluffy_Pillow 84.8/120: 71% focus sniper_training, megawatt_filament
4:01.066 steady_shot Fluffy_Pillow 84.8/120: 71% focus sniper_training, maalus, megawatt_filament
4:02.852 rapid_fire Fluffy_Pillow 106.8/120: 89% focus sniper_training, maalus, megawatt_filament
4:02.852 aimed_shot Fluffy_Pillow 106.8/120: 89% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
4:03.857 use_item_mirror_of_the_blademaster Fluffy_Pillow 83.1/120: 69% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
4:03.857 chimaera_shot Fluffy_Pillow 83.1/120: 69% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
4:04.862 aimed_shot Fluffy_Pillow 54.4/120: 45% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
4:05.868 aimed_shot Fluffy_Pillow 50.8/120: 42% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, maalus, megawatt_filament
4:06.872 aimed_shot Fluffy_Pillow 47.1/120: 39% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, maalus, megawatt_filament
4:07.878 aimed_shot Fluffy_Pillow 43.4/120: 36% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, maalus, megawatt_filament
4:08.882 steady_shot Fluffy_Pillow 39.7/120: 33% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
4:10.160 aimed_shot Fluffy_Pillow 61.7/120: 51% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
4:11.163 steady_shot Fluffy_Pillow 38.0/120: 32% focus careful_aim, rapid_fire, sniper_training, maalus, megawatt_filament
4:12.441 aimed_shot Fluffy_Pillow 60.1/120: 50% focus careful_aim, rapid_fire, sniper_training, maalus
4:13.445 chimaera_shot Fluffy_Pillow 36.4/120: 30% focus careful_aim, rapid_fire, sniper_training, maalus
4:14.449 steady_shot Fluffy_Pillow 7.7/120: 6% focus careful_aim, rapid_fire, sniper_training, maalus
4:15.725 steady_shot Fluffy_Pillow 29.7/120: 25% focus careful_aim, rapid_fire, sniper_training, maalus
4:17.002 aimed_shot Fluffy_Pillow 51.8/120: 43% focus careful_aim, rapid_fire, sniper_training, megawatt_filament
4:18.005 steady_shot Fluffy_Pillow 27.8/120: 23% focus careful_aim, sniper_training, megawatt_filament
4:19.790 steady_shot Fluffy_Pillow 49.8/120: 42% focus sniper_training, megawatt_filament
4:21.577 barrage Fluffy_Pillow 71.8/120: 60% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:24.433 steady_shot Fluffy_Pillow 24.7/120: 21% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:26.219 chimaera_shot Fluffy_Pillow 46.7/120: 39% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:27.225 steady_shot Fluffy_Pillow 16.2/120: 13% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
4:29.009 steady_shot Fluffy_Pillow 38.2/120: 32% focus thrill_of_the_hunt(3), sniper_training
4:30.794 steady_shot Fluffy_Pillow 60.2/120: 50% focus thrill_of_the_hunt(3), sniper_training
4:32.580 aimed_shot Fluffy_Pillow 82.2/120: 69% focus thrill_of_the_hunt(3), sniper_training
4:33.584 aimed_shot Fluffy_Pillow 76.8/120: 64% focus thrill_of_the_hunt(2), sniper_training
4:34.590 aimed_shot Fluffy_Pillow 71.3/120: 59% focus thrill_of_the_hunt, sniper_training
4:35.594 chimaera_shot Fluffy_Pillow 45.8/120: 38% focus sniper_training
4:36.597 steady_shot Fluffy_Pillow 15.3/120: 13% focus thrill_of_the_hunt(3), sniper_training, rapid_fire_t18
4:37.873 aimed_shot Fluffy_Pillow 37.3/120: 31% focus careful_aim, thrill_of_the_hunt(3), sniper_training, rapid_fire_t18
4:38.877 aimed_shot Fluffy_Pillow 33.6/120: 28% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18
4:39.883 steady_shot Fluffy_Pillow 29.9/120: 25% focus careful_aim, thrill_of_the_hunt(2), sniper_training, rapid_fire_t18
4:41.160 steady_shot Fluffy_Pillow 51.0/120: 42% focus thrill_of_the_hunt(2), sniper_training
4:42.945 barrage Fluffy_Pillow 73.0/120: 61% focus thrill_of_the_hunt(3), sniper_training
4:45.819 steady_shot Fluffy_Pillow 25.9/120: 22% focus thrill_of_the_hunt(3), sniper_training
4:47.604 chimaera_shot Fluffy_Pillow 47.9/120: 40% focus thrill_of_the_hunt(3), sniper_training
4:48.608 kill_shot Fluffy_Pillow 17.4/120: 15% focus thrill_of_the_hunt(3), sniper_training
4:49.613 kill_shot Fluffy_Pillow 21.9/120: 18% focus thrill_of_the_hunt(3), sniper_training
4:50.617 steady_shot Fluffy_Pillow 26.4/120: 22% focus thrill_of_the_hunt(3), sniper_training
4:52.403 steady_shot Fluffy_Pillow 48.5/120: 40% focus thrill_of_the_hunt(3), sniper_training
4:54.189 aimed_shot Fluffy_Pillow 70.5/120: 59% focus thrill_of_the_hunt(3), sniper_training
4:55.194 steady_shot Fluffy_Pillow 65.0/120: 54% focus thrill_of_the_hunt(2), sniper_training
4:56.980 chimaera_shot Fluffy_Pillow 87.0/120: 73% focus thrill_of_the_hunt(2), sniper_training
4:57.986 steady_shot Fluffy_Pillow 56.5/120: 47% focus thrill_of_the_hunt(2), sniper_training
4:59.770 kill_shot Fluffy_Pillow 78.5/120: 65% focus thrill_of_the_hunt(2), sniper_training
5:00.776 kill_shot Fluffy_Pillow 83.1/120: 69% focus thrill_of_the_hunt(2), sniper_training
5:01.783 aimed_shot Fluffy_Pillow 87.6/120: 73% focus thrill_of_the_hunt(2), sniper_training
5:02.788 steady_shot Fluffy_Pillow 62.1/120: 52% focus thrill_of_the_hunt, sniper_training
5:04.573 use_item_mirror_of_the_blademaster Fluffy_Pillow 84.1/120: 70% focus thrill_of_the_hunt, sniper_training
5:04.573 barrage Fluffy_Pillow 84.1/120: 70% focus thrill_of_the_hunt, sniper_training
5:07.436 chimaera_shot Fluffy_Pillow 37.0/120: 31% focus thrill_of_the_hunt, sniper_training
5:08.440 steady_shot Fluffy_Pillow 6.5/120: 5% focus thrill_of_the_hunt, sniper_training
5:10.226 steady_shot Fluffy_Pillow 28.5/120: 24% focus sniper_training
5:12.012 kill_shot Fluffy_Pillow 50.5/120: 42% focus sniper_training
5:13.016 kill_shot Fluffy_Pillow 55.0/120: 46% focus sniper_training
5:14.021 steady_shot Fluffy_Pillow 59.5/120: 50% focus sniper_training
5:15.804 steady_shot Fluffy_Pillow 81.5/120: 68% focus sniper_training
5:17.588 chimaera_shot Fluffy_Pillow 103.6/120: 86% focus sniper_training
5:18.590 aimed_shot Fluffy_Pillow 73.1/120: 61% focus thrill_of_the_hunt(3), sniper_training
5:19.595 steady_shot Fluffy_Pillow 47.6/120: 40% focus thrill_of_the_hunt(2), sniper_training
5:21.380 aimed_shot Fluffy_Pillow 69.6/120: 58% focus thrill_of_the_hunt(2), sniper_training
5:22.385 steady_shot Fluffy_Pillow 44.1/120: 37% focus thrill_of_the_hunt, sniper_training
5:24.171 kill_shot Fluffy_Pillow 66.1/120: 55% focus thrill_of_the_hunt, sniper_training
5:25.175 kill_shot Fluffy_Pillow 70.6/120: 59% focus thrill_of_the_hunt, sniper_training
5:26.180 barrage Fluffy_Pillow 75.1/120: 63% focus thrill_of_the_hunt, sniper_training, megawatt_filament
5:29.232 steady_shot Fluffy_Pillow 28.8/120: 24% focus thrill_of_the_hunt, sniper_training, megawatt_filament
5:31.018 chimaera_shot Fluffy_Pillow 50.9/120: 42% focus thrill_of_the_hunt, sniper_training, megawatt_filament
5:32.022 steady_shot Fluffy_Pillow 20.4/120: 17% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:33.808 steady_shot Fluffy_Pillow 42.4/120: 35% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:35.594 kill_shot Fluffy_Pillow 64.4/120: 54% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:36.598 kill_shot Fluffy_Pillow 68.9/120: 57% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
5:37.604 aimed_shot Fluffy_Pillow 73.4/120: 61% focus thrill_of_the_hunt(3), sniper_training
5:38.610 aimed_shot Fluffy_Pillow 68.0/120: 57% focus thrill_of_the_hunt(2), sniper_training
5:39.616 steady_shot Fluffy_Pillow 62.5/120: 52% focus thrill_of_the_hunt, sniper_training
5:41.402 chimaera_shot Fluffy_Pillow 84.5/120: 70% focus thrill_of_the_hunt, sniper_training
5:42.410 steady_shot Fluffy_Pillow 54.0/120: 45% focus thrill_of_the_hunt, sniper_training, rapid_fire_t18
5:43.685 aimed_shot Fluffy_Pillow 76.1/120: 63% focus careful_aim, thrill_of_the_hunt, sniper_training, rapid_fire_t18
5:44.689 aimed_shot Fluffy_Pillow 72.4/120: 60% focus careful_aim, sniper_training, rapid_fire_t18
5:45.693 steady_shot Fluffy_Pillow 48.7/120: 41% focus careful_aim, sniper_training, rapid_fire_t18
5:46.969 kill_shot Fluffy_Pillow 69.7/120: 58% focus sniper_training
5:47.970 kill_shot Fluffy_Pillow 74.2/120: 62% focus sniper_training
5:48.975 barrage Fluffy_Pillow 78.7/120: 66% focus thrill_of_the_hunt(3), sniper_training
5:51.963 steady_shot Fluffy_Pillow 32.1/120: 27% focus thrill_of_the_hunt(3), sniper_training
5:53.749 chimaera_shot Fluffy_Pillow 54.1/120: 45% focus thrill_of_the_hunt(3), sniper_training
5:54.755 steady_shot Fluffy_Pillow 23.7/120: 20% focus thrill_of_the_hunt(3), sniper_training
5:56.541 steady_shot Fluffy_Pillow 45.7/120: 38% focus thrill_of_the_hunt(3), sniper_training
5:58.327 kill_shot Fluffy_Pillow 67.7/120: 56% focus thrill_of_the_hunt(3), sniper_training
5:59.331 kill_shot Fluffy_Pillow 72.2/120: 60% focus thrill_of_the_hunt(3), sniper_training
6:00.335 steady_shot Fluffy_Pillow 76.7/120: 64% focus thrill_of_the_hunt(3), sniper_training
6:02.120 use_item_maalus_the_blood_drinker Fluffy_Pillow 98.7/120: 82% focus thrill_of_the_hunt(3), sniper_training
6:02.120 steady_shot Fluffy_Pillow 98.7/120: 82% focus thrill_of_the_hunt(3), sniper_training, maalus
6:03.906 chimaera_shot Fluffy_Pillow 120.0/120: 100% focus thrill_of_the_hunt(3), sniper_training, maalus
6:04.911 use_item_mirror_of_the_blademaster Fluffy_Pillow 89.5/120: 75% focus thrill_of_the_hunt(3), sniper_training, maalus
6:04.911 rapid_fire Fluffy_Pillow 89.5/120: 75% focus thrill_of_the_hunt(3), sniper_training, maalus
6:04.911 stampede Fluffy_Pillow 89.5/120: 75% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, maalus
6:05.916 aimed_shot Fluffy_Pillow 95.8/120: 80% focus careful_aim, thrill_of_the_hunt(3), rapid_fire, sniper_training, stampede, maalus
6:06.921 aimed_shot Fluffy_Pillow 92.2/120: 77% focus careful_aim, thrill_of_the_hunt(2), rapid_fire, sniper_training, stampede, maalus
6:07.925 aimed_shot Fluffy_Pillow 88.5/120: 74% focus careful_aim, thrill_of_the_hunt, rapid_fire, sniper_training, stampede, maalus
6:08.928 aimed_shot Fluffy_Pillow 84.8/120: 71% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:09.934 kill_shot Fluffy_Pillow 61.1/120: 51% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:10.937 kill_shot Fluffy_Pillow 67.4/120: 56% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:11.942 aimed_shot Fluffy_Pillow 73.7/120: 61% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:12.948 chimaera_shot Fluffy_Pillow 50.0/120: 42% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:13.954 steady_shot Fluffy_Pillow 21.4/120: 18% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:15.229 steady_shot Fluffy_Pillow 43.4/120: 36% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:16.505 aimed_shot Fluffy_Pillow 65.4/120: 55% focus careful_aim, rapid_fire, sniper_training, stampede, maalus
6:17.510 steady_shot Fluffy_Pillow 41.7/120: 35% focus careful_aim, rapid_fire, sniper_training, stampede
6:18.786 aimed_shot Fluffy_Pillow 63.7/120: 53% focus careful_aim, rapid_fire, sniper_training, stampede
6:19.790 steady_shot Fluffy_Pillow 40.1/120: 33% focus careful_aim, rapid_fire, sniper_training, stampede
6:21.067 kill_shot Fluffy_Pillow 60.0/120: 50% focus sniper_training, stampede
6:22.072 chimaera_shot Fluffy_Pillow 64.5/120: 54% focus sniper_training, stampede
6:23.076 kill_shot Fluffy_Pillow 34.0/120: 28% focus sniper_training, stampede
6:24.082 steady_shot Fluffy_Pillow 38.6/120: 32% focus sniper_training, stampede
6:25.868 barrage Fluffy_Pillow 60.6/120: 50% focus thrill_of_the_hunt(3), sniper_training, stampede
6:28.799 steady_shot Fluffy_Pillow 13.7/120: 11% focus thrill_of_the_hunt(3), sniper_training, stampede
6:30.582 steady_shot Fluffy_Pillow 35.7/120: 30% focus thrill_of_the_hunt(3), sniper_training, stampede
6:32.368 chimaera_shot Fluffy_Pillow 57.8/120: 48% focus thrill_of_the_hunt(3), sniper_training, stampede
6:33.372 kill_shot Fluffy_Pillow 27.3/120: 23% focus thrill_of_the_hunt(3), sniper_training, stampede
6:34.378 kill_shot Fluffy_Pillow 31.8/120: 26% focus thrill_of_the_hunt(3), sniper_training, stampede
6:35.383 steady_shot Fluffy_Pillow 36.3/120: 30% focus thrill_of_the_hunt(3), sniper_training, stampede
6:37.167 steady_shot Fluffy_Pillow 58.3/120: 49% focus thrill_of_the_hunt(3), sniper_training, stampede
6:38.952 aimed_shot Fluffy_Pillow 80.3/120: 67% focus thrill_of_the_hunt(3), sniper_training, stampede
6:39.957 steady_shot Fluffy_Pillow 54.8/120: 46% focus thrill_of_the_hunt(2), sniper_training, stampede
6:41.743 chimaera_shot Fluffy_Pillow 76.9/120: 64% focus thrill_of_the_hunt(2), sniper_training, stampede
6:42.746 steady_shot Fluffy_Pillow 46.4/120: 39% focus thrill_of_the_hunt(2), sniper_training, stampede
6:44.531 kill_shot Fluffy_Pillow 68.4/120: 57% focus thrill_of_the_hunt(2), sniper_training, stampede
6:45.535 kill_shot Fluffy_Pillow 72.9/120: 61% focus thrill_of_the_hunt(2), sniper_training
6:46.539 barrage Fluffy_Pillow 77.4/120: 65% focus thrill_of_the_hunt(2), sniper_training
6:49.497 steady_shot Fluffy_Pillow 30.7/120: 26% focus sniper_training
6:51.282 chimaera_shot Fluffy_Pillow 52.7/120: 44% focus sniper_training, megawatt_filament
6:52.287 steady_shot Fluffy_Pillow 22.2/120: 19% focus sniper_training, megawatt_filament
6:54.073 steady_shot Fluffy_Pillow 44.2/120: 37% focus sniper_training, megawatt_filament
6:55.857 kill_shot Fluffy_Pillow 66.3/120: 55% focus sniper_training, megawatt_filament
6:56.861 kill_shot Fluffy_Pillow 70.8/120: 59% focus sniper_training, megawatt_filament
6:57.865 steady_shot Fluffy_Pillow 75.3/120: 63% focus sniper_training, megawatt_filament
6:59.651 aimed_shot Fluffy_Pillow 97.3/120: 81% focus sniper_training, megawatt_filament
7:00.656 chimaera_shot Fluffy_Pillow 51.8/120: 43% focus sniper_training, megawatt_filament
7:01.660 steady_shot Fluffy_Pillow 21.3/120: 18% focus sniper_training, megawatt_filament
7:03.444 steady_shot Fluffy_Pillow 43.3/120: 36% focus sniper_training
7:05.229 use_item_mirror_of_the_blademaster Fluffy_Pillow 65.3/120: 54% focus sniper_training
7:05.229 steady_shot Fluffy_Pillow 65.3/120: 54% focus sniper_training
7:07.017 kill_shot Fluffy_Pillow 87.4/120: 73% focus sniper_training, megawatt_filament
7:08.020 kill_shot Fluffy_Pillow 91.9/120: 77% focus sniper_training, megawatt_filament
7:09.024 barrage Fluffy_Pillow 96.4/120: 80% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
7:12.025 chimaera_shot Fluffy_Pillow 49.9/120: 42% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
7:13.031 steady_shot Fluffy_Pillow 19.4/120: 16% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
7:14.816 steady_shot Fluffy_Pillow 41.4/120: 34% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
7:16.602 steady_shot Fluffy_Pillow 63.4/120: 53% focus thrill_of_the_hunt(3), sniper_training, megawatt_filament
7:18.387 kill_shot Fluffy_Pillow 85.4/120: 71% focus thrill_of_the_hunt(3), sniper_training
7:19.391 kill_shot Fluffy_Pillow 89.9/120: 75% focus thrill_of_the_hunt(3), sniper_training
7:20.396 aimed_shot Fluffy_Pillow 94.5/120: 79% focus thrill_of_the_hunt(3), sniper_training
7:21.403 chimaera_shot Fluffy_Pillow 69.0/120: 57% focus thrill_of_the_hunt(2), sniper_training
7:22.407 steady_shot Fluffy_Pillow 38.5/120: 32% focus thrill_of_the_hunt(2), sniper_training
7:24.193 steady_shot Fluffy_Pillow 60.5/120: 50% focus thrill_of_the_hunt(2), sniper_training

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 926 882 882
Agility 7657 7030 6760 (1342)
Stamina 8388 7626 7626
Intellect 896 854 854
Spirit 711 711 711
Health 503280 457560 0
Focus 120 120 0
Crit 56.35% 50.15% 3867
Haste 12.27% 6.93% 528
Multistrike 25.30% 20.30% 1340
Damage / Heal Versatility 5.08% 2.08% 270
Attack Power 8423 7030 0
Mastery 16.28% 13.16% 1435
Armor 1742 1742 1742
Run Speed 0 0 182
Leech 4.09% 4.09% 286

Gear

Source Slot Average Item Level: 737.00
Local Head Hood of the Savage Hunt
ilevel: 735, stats: { 235 Armor, +444 Agi, +667 Sta, +346 Mult, +245 Mastery }
Local Neck Faulty Detonator Cord
ilevel: 730, stats: { +238 Agi, +357 Sta, +186 Crit, +131 Mult }, gems: { +75 Crit }, enchant: { +75 Crit }
Local Shoulders Pauldrons of the Savage Hunt
ilevel: 726, stats: { 208 Armor, +307 Agi, +460 Sta, +239 Haste, +169 Mult, +175 unknown }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Vestment of Illusory Might
ilevel: 741, stats: { 297 Armor, +470 AgiInt, +704 Sta, +447 Crit, +179 Mastery }
Local Waist Torch-Brazed Waistguard
ilevel: 730, stats: { 159 Armor, +318 AgiInt, +477 Sta, +248 Mult, +175 Crit }
Local Legs Leggings of the Savage Hunt
ilevel: 735, stats: { 253 Armor, +444 Agi, +667 Sta, +372 Crit, +220 Mult }, gems: { +75 Crit }
Local Feet Spiked Throatcrusher Boots
ilevel: 725, stats: { 190 Armor, +304 AgiInt, +456 Sta, +280 Crit, +124 Mult }
Local Wrists Chain Wristguards of the Stricken
ilevel: 735, stats: { 126 Armor, +250 AgiInt, +375 Sta, +202 Crit, +131 Mastery }
Local Hands Gloves of the Savage Hunt
ilevel: 735, stats: { 180 Armor, +333 Agi, +500 Sta, +279 Mastery, +165 Haste }
Local Finger1 Serrated Demontooth Ring
ilevel: 735, stats: { +250 Agi, +375 Sta, +209 Crit, +124 Haste, +143 Leech }, enchant: { +50 Crit }
Local Finger2 Maalus, the Blood Drinker
ilevel: 795, stats: { +437 Agi, +656 Sta, +304 Crit, +270 Vers }, enchant: { +50 Crit }
Local Trinket1 Fel-Spring Coil
ilevel: 730, stats: { +394 Agi, +394 Mastery, +394 Crit }, gems: { +75 Crit }
Local Trinket2 Mirror of the Blademaster
ilevel: 730, stats: { +525 Agi, +182 RunSpeed }
Local Back Cloak of Desperate Temerity
ilevel: 735, stats: { 94 Armor, +250 Agi, +375 Sta, +230 Crit, +102 Mult, +143 Leech }, enchant: { +100 Crit }
Local Main Hand Felcrystal Impaler
ilevel: 735, weapon: { 1916 - 2875, 3 }, stats: { +444 Agi, +667 Sta, +384 Crit, +207 Mastery }, enchant: megawatt_filament

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Marksmanship Hunter) Lone Wolf

Profile

hunter="Oule"
origin="https://eu.api.battle.net/wow/character/arathor/Oule/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hellfire/218/121271770-avatar.jpg"
level=100
race=night_elf
timeofday=night
role=attack
position=ranged_back
professions=engineering=700/enchanting=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#YZ!2012222
talent_override=lone_wolf,if=raid_event.adds.count>=3|enemies>1
glyphs=chimaera_shot/disengage/deterrence/aspect_of_the_cheetah/aspect_of_the_pack/revive_pet
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=pickled_eel
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=spell_targets.multi_shot<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=spell_targets.multi_shot>=3
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/glaive_toss
actions.precombat+=/focusing_shot

# Executed every time the actor is available.

actions=auto_shot
actions+=/use_item,name=torchbrazed_waistguard
actions+=/use_item,name=maalus_the_blood_drinker
actions+=/use_item,name=mirror_of_the_blademaster
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=((buff.rapid_fire.up|buff.bloodlust.up)&(cooldown.stampede.remains<1))|target.time_to_die<=25
actions+=/chimaera_shot
actions+=/kill_shot
actions+=/rapid_fire
actions+=/stampede,if=buff.rapid_fire.up|buff.bloodlust.up|target.time_to_die<=25
actions+=/call_action_list,name=careful_aim,if=buff.careful_aim.up
actions+=/explosive_trap,if=spell_targets.explosive_trap_tick>1
actions+=/a_murder_of_crows
actions+=/dire_beast,if=cast_regen+action.aimed_shot.cast_regen<focus.deficit
actions+=/glaive_toss
actions+=/powershot,if=cast_regen<focus.deficit
actions+=/barrage
# Pool max focus for rapid fire so we can spam AimedShot with Careful Aim buff
actions+=/steady_shot,if=focus.deficit*cast_time%(14+cast_regen)>cooldown.rapid_fire.remains
actions+=/focusing_shot,if=focus.deficit*cast_time%(50+cast_regen)>cooldown.rapid_fire.remains&focus<100
# Cast a second shot for steady focus if that won't cap us.
actions+=/steady_shot,if=buff.pre_steady_focus.up&(14+cast_regen+action.aimed_shot.cast_regen)<=focus.deficit
actions+=/multishot,if=spell_targets.multi_shot>6
actions+=/aimed_shot,if=talent.focusing_shot.enabled
actions+=/aimed_shot,if=focus+cast_regen>=85
actions+=/aimed_shot,if=buff.thrill_of_the_hunt.react&focus+cast_regen>=65
# Allow FS to over-cap by 10 if we have nothing else to do
actions+=/focusing_shot,if=50+cast_regen-10<focus.deficit
actions+=/steady_shot

actions.careful_aim=glaive_toss,if=active_enemies>2
actions.careful_aim+=/powershot,if=spell_targets.powershot>1&cast_regen<focus.deficit
actions.careful_aim+=/barrage,if=spell_targets.barrage>1
actions.careful_aim+=/aimed_shot
actions.careful_aim+=/focusing_shot,if=50+cast_regen<focus.deficit
actions.careful_aim+=/steady_shot

head=hood_of_the_savage_hunt,id=124296,bonus_id=567,upgrade=2
neck=faulty_detonator_cord,id=124207,bonus_id=565/567,upgrade=2,gems=75crit,enchant=75crit
shoulders=pauldrons_of_the_savage_hunt,id=124307,bonus_id=43/561/566,upgrade=2
back=cloak_of_desperate_temerity,id=124134,bonus_id=41/567,upgrade=2,enchant=gift_of_critical_strike
chest=vestment_of_illusory_might,id=124282,bonus_id=562/567,upgrade=2
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=chain_wristguards_of_the_stricken,id=124313,bonus_id=567,upgrade=2
hands=gloves_of_the_savage_hunt,id=124292,bonus_id=567,upgrade=2
waist=torchbrazed_waistguard,id=124309,bonus_id=567,upgrade=2,addon=nitro_boosts
legs=leggings_of_the_savage_hunt,id=124301,bonus_id=565/567,upgrade=2,gems=75crit
feet=spiked_throatcrusher_boots,id=124287,bonus_id=566,upgrade=2
finger1=serrated_demontooth_ring,id=124188,bonus_id=41/567,upgrade=2,enchant=50crit
finger2=maalus_the_blood_drinker,id=124636,bonus_id=641/650,enchant=50crit
trinket1=felspring_coil,id=124223,bonus_id=565/567,upgrade=2,gems=75crit
trinket2=mirror_of_the_blademaster,id=124224,bonus_id=42/567,upgrade=2
main_hand=felcrystal_impaler,id=124362,bonus_id=567,upgrade=2,enchant=megawatt_filament

# Gear Summary
# gear_ilvl=736.80
# gear_agility=5408
# gear_stamina=6736
# gear_crit_rating=3683
# gear_haste_rating=528
# gear_mastery_rating=1435
# gear_multistrike_rating=1340
# gear_versatility_rating=270
# gear_leech_rating=286
# gear_speed_rating=182
# gear_armor=1742
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1
summon_pet=cat

Zoleex

Zoleex : 53187 dps, 53187 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
53186.6 53186.6 19.8 / 0.037% 6295.2 / 11.8% 4567.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.8 10.8 Focus 0.00% 37.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/arathor/Zoleex/advanced
Talents
  • 15: Posthaste
  • 30: Binding Shot
  • 45: Iron Hawk
  • 60: Thrill of the Hunt
  • 75: Stampede
  • 90: Barrage
  • 100: Lone Wolf
  • Talent Calculator
Glyphs
  • Glyph of Chimaera Shot
  • Glyph of Deterrence
  • Glyph of Disengage
  • Glyph of Revive Pet
  • Glyph of Aspect of the Cheetah
  • Glyph of Aspect of the Pack
Professions
  • alchemy: 700
  • jewelcrafting: 700

Charts